BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0115 (771 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 25 2.6 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 7.9 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 25.0 bits (52), Expect = 2.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 104 VPCGVYLH*IHLQRTCQRDPLVKKIHHHYHPL 9 +PC + Q C ++P+ K + +H+H L Sbjct: 143 LPCPDRCTAAYKQELCFQEPIAKYLDYHFHDL 174 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 106 QRQRCNSSIISNIGGVVLWHSQK 174 Q ++ NS I ++GG + W ++K Sbjct: 797 QDRKSNSGFIFHLGGPISWSARK 819 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 823,414 Number of Sequences: 2352 Number of extensions: 16788 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -