BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0113 (735 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08560.1 68416.m00993 vacuolar ATP synthase subunit E, putati... 62 4e-10 At4g11150.1 68417.m01807 vacuolar ATP synthase subunit E / V-ATP... 60 1e-09 At1g64200.1 68414.m07273 vacuolar ATP synthase subunit E, putati... 59 3e-09 At3g54280.1 68416.m05999 SNF2 domain-containing protein / helica... 29 4.2 At3g03790.2 68416.m00389 ankyrin repeat family protein / regulat... 29 4.2 At3g03790.1 68416.m00388 ankyrin repeat family protein / regulat... 29 4.2 At3g58810.2 68416.m06555 zinc transporter, putative similar to z... 28 5.6 At3g58810.1 68416.m06554 zinc transporter, putative similar to z... 28 5.6 At5g35910.1 68418.m04312 3'-5' exonuclease domain-containing pro... 28 7.4 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 28 7.4 At1g50980.1 68414.m05731 F-box family protein contains F-box dom... 28 7.4 At1g30280.1 68414.m03703 expressed protein contains low similari... 28 7.4 At2g35610.1 68415.m04365 expressed protein 27 9.8 At1g64940.1 68414.m07361 cytochrome P450, putative similar to cy... 27 9.8 At1g63330.1 68414.m07159 pentatricopeptide (PPR) repeat-containi... 27 9.8 At1g20180.1 68414.m02522 hypothetical protein similar to At14a (... 27 9.8 >At3g08560.1 68416.m00993 vacuolar ATP synthase subunit E, putative / V-ATPase E subunit, putative / vacuolar proton pump E subunit, putative similar to SP|Q39258 Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) {Arabidopsis thaliana}; contains Pfam profile PF01991: ATP synthase (E/31 kDa) subunit Length = 235 Score = 62.1 bits (144), Expect = 4e-10 Identities = 48/157 (30%), Positives = 76/157 (48%), Gaps = 14/157 (8%) Frame = +2 Query: 305 SNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPTV 484 S LN +R+K L+ ++D V + D A K L V D Y +LL +LI+++L +L EP+V Sbjct: 71 STQLNASRIKYLQAQDDVVTAMKDSAAKDLLRVSNDKNNYKKLLKSLIIESLLRLKEPSV 130 Query: 485 TIRVRQTDRLWWSPCSEKLNKTTRIRSRRTLC*KSTL--RTFCRPTPVVVIE-------- 634 +R R+ D+ E K + K T+ + F P P + Sbjct: 131 LLRCREMDKKVVESVIEDA-KRQYAEKAKVGSPKITIDEKVFLPPPPNPKLPDSHDPHCS 189 Query: 635 ----LVAARGRIKISNTLESRLELIAQQLLPEIRNAL 733 L + G+I NTL++RL++ +Q LP+IR L Sbjct: 190 GGVVLASQDGKIVCENTLDARLDVAFRQKLPQIRTRL 226 Score = 34.7 bits (76), Expect = 0.064 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 96 LSDADVQKQIKHMMAFIEQXXXXXXXXXXXXXXXXFNIEKGRLVQQQRLKIME 254 ++DADV KQI+ M+ FI Q FNIE+ +L++ + K+ + Sbjct: 1 MNDADVSKQIQQMVRFIRQEAEEKANEISISAEEEFNIERLQLLESAKRKLRQ 53 >At4g11150.1 68417.m01807 vacuolar ATP synthase subunit E / V-ATPase E subunit / vacuolar proton pump E subunit (VATE) identical to SP|Q39258 Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) {Arabidopsis thaliana} Length = 230 Score = 60.5 bits (140), Expect = 1e-09 Identities = 47/157 (29%), Positives = 74/157 (47%), Gaps = 14/157 (8%) Frame = +2 Query: 305 SNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPTV 484 S LN +R+KVL+ ++D V + D+A K L V +D Y +LL LIVQ L +L EP+V Sbjct: 71 SMQLNASRIKVLQAQDDIVNAMKDQAAKDLLNVSRDEYAYKQLLKDLIVQCLLRLKEPSV 130 Query: 485 TIRVRQTD----RLWWSPCSEKLNKTTRIRSRRTLC*KSTLRTFCRPTPVV--------- 625 +R R+ D E+ ++ + + F P P Sbjct: 131 LLRCREEDLGLVEAVLDDAKEEYAGKAKVHAPEVAV---DTKIFLPPPPKSNDPHGLHCS 187 Query: 626 -VIELVAARGRIKISNTLESRLELIAQQLLPEIRNAL 733 + L + G+I NTL++RL++ + LP IR +L Sbjct: 188 GGVVLASRDGKIVCENTLDARLDVAFRMKLPVIRKSL 224 >At1g64200.1 68414.m07273 vacuolar ATP synthase subunit E, putative / V-ATPase E subunit, putative / vacuolar proton pump E subunit, putative similar to SP|Q39258 Vacuolar ATP synthase subunit E (EC 3.6.3.14) (V-ATPase E subunit) (Vacuolar proton pump E subunit) {Arabidopsis thaliana}; contains Pfam profile PF01991: ATP synthase (E/31 kDa) subunit Length = 237 Score = 58.8 bits (136), Expect = 3e-09 Identities = 51/163 (31%), Positives = 77/163 (47%), Gaps = 20/163 (12%) Frame = +2 Query: 305 SNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKL------YSELLVTLIVQALFQ 466 S LN +R+KVL+ ++D V + +EA K+L +V + Y LL LIVQ L + Sbjct: 71 SMQLNASRIKVLQAQDDIVNAMKEEAAKQLLKVSQHGFFNHHHHQYKHLLKDLIVQCLLR 130 Query: 467 LMEPTVTIRVRQTD----RLWWSPCSEKLNKTTRIRSRRTLC*KSTLRTFCRPTP----- 619 L EP V +R R+ D SE+ K ++ + + K F P P Sbjct: 131 LKEPAVLLRCREEDLDIVESMLDDASEEYCKKAKVHAPEIIVDKD---IFLPPAPSDDDP 187 Query: 620 -----VVVIELVAARGRIKISNTLESRLELIAQQLLPEIRNAL 733 + L + G+I NTL++RLE+ + LPEIR +L Sbjct: 188 HALSCAGGVVLASRDGKIVCENTLDARLEVAFRNKLPEIRKSL 230 >At3g54280.1 68416.m05999 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|O14981 TBP-associated factor 172 (TAF-172) (TAF(II)170) {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2049 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = -2 Query: 392 GACELHQVHYVRDLHALS----VPSDELGSACSKIGSSSEVQPASPSFHSFHN-LETLLL 228 G+CE+ V + H S + SD L S+ + IG+ +++P FH+ +E L+L Sbjct: 250 GSCEVADVE-MSSSHVASTSKRILSDSLDSSKADIGNEDDIEPDGDGKWPFHSFVEQLIL 308 Query: 227 D 225 D Sbjct: 309 D 309 >At3g03790.2 68416.m00389 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1081 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 38 ALYRPFFVLVVLKISSSHGAQRCRCSETDQAHDG 139 +LY P + +VLK S + A +CR E ++ +G Sbjct: 508 SLYHPAYAPIVLKKSQTLQADKCREEENEELDEG 541 >At3g03790.1 68416.m00388 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1078 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 38 ALYRPFFVLVVLKISSSHGAQRCRCSETDQAHDG 139 +LY P + +VLK S + A +CR E ++ +G Sbjct: 505 SLYHPAYAPIVLKKSQTLQADKCREEENEELDEG 538 >At3g58810.2 68416.m06555 zinc transporter, putative similar to zinc transporter 4; ZnT4 [Mus musculus] gi|2582990|gb|AAB82593; similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 393 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 410 PLALQPGACELHQVHYVRDLHALSVPSDELGSAC 309 P L+ G CE+ +V V +LH ++ +L AC Sbjct: 323 PTMLEKGVCEIEEVVAVHELHIWAITVGKLLLAC 356 >At3g58810.1 68416.m06554 zinc transporter, putative similar to zinc transporter 4; ZnT4 [Mus musculus] gi|2582990|gb|AAB82593; similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 432 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 410 PLALQPGACELHQVHYVRDLHALSVPSDELGSAC 309 P L+ G CE+ +V V +LH ++ +L AC Sbjct: 362 PTMLEKGVCEIEEVVAVHELHIWAITVGKLLLAC 395 >At5g35910.1 68418.m04312 3'-5' exonuclease domain-containing protein / helicase and RNase D C-terminal domain-containing protein / HRDC domain-containing protein low similarity to SP|Q01780 Polymyositis/scleroderma autoantigen 2 {Homo sapiens}; contains Pfam profiles PF00570: HRDC domain, PF01612: 3'-5' exonuclease Length = 838 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 362 VRDLHALSVPSDELGSACSKIGSSSEVQPASPSFHSFHNLE 240 V+ L L + S S++ SSS + P S FH ++N + Sbjct: 17 VKSLEKL-IDGSSFSSTLSRLSSSSRLIPTSRDFHFYYNFD 56 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 329 LKVLKVREDHVRNVLDEARKRLAEV 403 LK +KV+ED N+LDE ++ L+EV Sbjct: 54 LKRIKVQEDRGLNLLDEVQQWLSEV 78 >At1g50980.1 68414.m05731 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 266 SFHSFHNLETLLLDKTALFD 207 SF+ F LET++LDK +L D Sbjct: 124 SFYMFSQLETVILDKVSLMD 143 >At1g30280.1 68414.m03703 expressed protein contains low similarity to cyclin G-associated kinase GI:1902912 SP|P97874 from [Rattus norvegicus] Length = 455 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/75 (21%), Positives = 34/75 (45%) Frame = +1 Query: 484 HHPRPSNRQALVESLLGKAQQDYKNKIKKDVVLKVDTENFLSPDTCGGNRAGCSQGTYQD 663 H + +NR VE ++ + ++D + + V++++++ F GG G S D Sbjct: 255 HAKQRTNRDCKVEEVVVEDEEDEEEEEMSSYVIEINSDRFDRYREEGGGGGGNSDSNDMD 314 Query: 664 QQHSGVSLGADRPAA 708 + + + RP A Sbjct: 315 EAIAWAKERSQRPEA 329 >At2g35610.1 68415.m04365 expressed protein Length = 644 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = -2 Query: 353 LHALSVPSDELGSACSKIGSSSEVQPASPSFHSFHNLETLLLDKTALFDVELLL 192 L+ VP ++GS S + +V SP+FH + +L+D F ELL+ Sbjct: 175 LYWKGVPVFDMGSHMSTV----DVGWGSPTFHKMGREKVILIDSVLPFGYELLM 224 >At1g64940.1 68414.m07361 cytochrome P450, putative similar to cytochrome p450 GI:438242 from [Solanum melongena] Length = 511 Score = 27.5 bits (58), Expect = 9.8 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = +2 Query: 362 RNVLDEARKRLAEVPKDTKLYSELLVTLIVQALFQLMEPTVTIRVRQTDRLWWSPCSEKL 541 R ++DE +KR +E KD K Y V V L + P ++ + + + S CSE L Sbjct: 258 RKIVDERKKRSSEEEKDNKEY----VQSYVDTLLDVELPDEKRKLNEDEIV--SLCSEFL 311 Query: 542 NKTT 553 N T Sbjct: 312 NAGT 315 >At1g63330.1 68414.m07159 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 558 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 529 LGKAQQDYKNKIKKDVVLKVDTENFLSPDTCGGNRAGCSQGTYQDQQHSGV 681 L KA+Q ++ + KD +DT N L C R +++ H G+ Sbjct: 305 LDKAKQMFEFMVSKDCFPDLDTYNTLIKGFCKSKRVEDGTELFREMSHRGL 355 >At1g20180.1 68414.m02522 hypothetical protein similar to At14a (GI:11994571 and GI:11994573) [Arabidopsis thaliana] Length = 391 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -2 Query: 329 DELG-SACSKIGSSSEVQPASPSFHSFHNLET-LLLD 225 D+LG ++CSK+ SSS P+S S SFH+ T LLD Sbjct: 59 DQLGITSCSKLSSSSP-SPSSSSDLSFHSHFTDYLLD 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,363,646 Number of Sequences: 28952 Number of extensions: 273822 Number of successful extensions: 810 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -