BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0112 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 6.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.9 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 7.9 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 7.9 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/30 (23%), Positives = 19/30 (63%) Frame = -3 Query: 335 LITFSQTKKCLLNWKGFLAITYINTIKYSI 246 +++ + ++C N+K + +++NTI Y + Sbjct: 134 IVSGAMAERC--NFKAYCLFSFLNTIVYCV 161 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 Query: 504 TRLRNVLYPPILNKPA 551 T + V+YPP++ P+ Sbjct: 838 TTMAGVIYPPVIGTPS 853 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 226 ETLNGFIIEYFIVFM*VMAKKPFQF 300 E NG I+ Y++ + ++KP+ F Sbjct: 1003 EDWNGEILGYYVGYRLSSSEKPYMF 1027 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 377 WIQSTTYNIALIVDLITFSQTKKC 306 W ++ + I L L+ FS+ K C Sbjct: 72 WTITSYHRINLKCSLVEFSENKNC 95 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -3 Query: 161 HTRVLSLETGGDV 123 H R++S++ GGD+ Sbjct: 226 HLRIISMQMGGDL 238 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,698 Number of Sequences: 438 Number of extensions: 3223 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -