BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0112 (664 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16520.1 68418.m01932 expressed protein 31 0.90 At1g75400.1 68414.m08759 expressed protein 28 6.4 >At5g16520.1 68418.m01932 expressed protein Length = 608 Score = 30.7 bits (66), Expect = 0.90 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 466 SFVTESTREGTLMKFECTQCNSTNDNLF 383 S+ ++T G + F+CT+C TND ++ Sbjct: 225 SYTCKNTTSGPTVNFKCTKCRLTNDYIY 252 >At1g75400.1 68414.m08759 expressed protein Length = 455 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 526 YKTFRNRVTYILAEKKNEVFSFVTESTREGTLMKFE--CTQCNSTN 395 YK +NRV E + + F F REG +K E C+ +S+N Sbjct: 359 YKRCKNRVVDSYGESECDEFVFQKMGKREGKALKLEASCSSKSSSN 404 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,061,423 Number of Sequences: 28952 Number of extensions: 252835 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -