BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0109 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 64 1e-12 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 64.1 bits (149), Expect = 1e-12 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 4/117 (3%) Frame = +2 Query: 338 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA* 517 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G++L+A Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMAC 239 Query: 518 PKRVPAKRWAYILPAIVHINNQP----PIRRGDGPIALVLAPTRELAQQISASCCRF 676 + K A+ +P I + + P ++++PTREL QI +F Sbjct: 240 AQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKF 296 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -2 Query: 245 PIWATHVLTSRQFFFP 198 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 79 TGIIAVETVVPNLEEATNSA 138 T + A V P +EE TN+A Sbjct: 412 TALGAAALVAPGMEEPTNTA 431 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -2 Query: 245 PIWATHVLTSRQFFFP 198 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 521 KRVPAKRWAYILPAIVHINNQPPIRRGDGPIALVLA 628 +++P + A I P + + P R GP+A V A Sbjct: 533 QKIPLRMTAGIDPKSIFNSGYRPKPRMSGPVAAVAA 568 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,793 Number of Sequences: 438 Number of extensions: 4146 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -