BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0106 (480 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12230.1 68418.m01435 expressed protein 37 0.008 At5g57370.1 68418.m07168 expressed protein low similarity to nuc... 34 0.057 At5g19480.1 68418.m02321 expressed protein 34 0.057 At5g48610.1 68418.m06012 expressed protein ; expression supporte... 33 0.075 At3g29075.1 68416.m03637 glycine-rich protein 33 0.075 At3g23930.1 68416.m03006 expressed protein 33 0.075 At5g53800.1 68418.m06685 expressed protein 33 0.100 At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar... 32 0.17 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 32 0.17 At1g65280.1 68414.m07402 DNAJ heat shock N-terminal domain-conta... 31 0.30 At1g07840.2 68414.m00851 leucine zipper factor-related similar t... 31 0.30 At1g07840.1 68414.m00850 leucine zipper factor-related similar t... 31 0.30 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 31 0.40 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 31 0.40 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 31 0.40 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 31 0.40 At5g53440.1 68418.m06641 expressed protein 31 0.53 At2g33435.1 68415.m04098 RNA recognition motif (RRM)-containing ... 31 0.53 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 31 0.53 At5g57120.1 68418.m07132 expressed protein weak similarity to SP... 30 0.70 At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein... 30 0.70 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 30 0.93 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 30 0.93 At2g41960.1 68415.m05191 expressed protein 30 0.93 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 29 1.2 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 29 1.2 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 29 1.2 At3g53640.1 68416.m05925 protein kinase family protein contains ... 29 1.6 At3g28770.1 68416.m03591 expressed protein 29 1.6 At1g69070.1 68414.m07903 expressed protein 29 1.6 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 29 2.1 At5g27860.1 68418.m03342 expressed protein 29 2.1 At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) fa... 29 2.1 At5g37370.2 68418.m04490 pre-mRNA splicing factor PRP38 family p... 28 2.8 At5g37370.1 68418.m04489 pre-mRNA splicing factor PRP38 family p... 28 2.8 At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp... 28 2.8 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 28 3.7 At5g05570.1 68418.m00605 transducin family protein / WD-40 repea... 27 5.0 At4g01560.1 68417.m00202 brix domain-containing protein contains... 27 5.0 At3g58050.1 68416.m06471 expressed protein 27 5.0 At3g26560.1 68416.m03315 ATP-dependent RNA helicase, putative si... 27 5.0 At3g13980.1 68416.m01765 expressed protein 27 5.0 At2g40650.1 68415.m05016 pre-mRNA splicing factor PRP38 family p... 27 5.0 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 6.5 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 6.5 At5g44310.2 68418.m05424 late embryogenesis abundant domain-cont... 27 6.5 At5g44310.1 68418.m05423 late embryogenesis abundant domain-cont... 27 6.5 At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative ... 27 6.5 At4g35940.1 68417.m05113 expressed protein 27 6.5 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 27 6.5 At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family ... 27 6.5 At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related simil... 27 6.5 At1g08450.2 68414.m00935 calreticulin 3 (CRT3) identical to simi... 27 6.5 At1g08450.1 68414.m00934 calreticulin 3 (CRT3) identical to simi... 27 6.5 At5g05210.1 68418.m00555 nucleolar matrix protein-related contai... 27 8.7 At4g14350.2 68417.m02211 protein kinase family protein contains ... 27 8.7 At4g14350.1 68417.m02210 protein kinase family protein contains ... 27 8.7 At3g51640.1 68416.m05663 expressed protein 27 8.7 At2g27285.1 68415.m03279 expressed protein weak similarity to ma... 27 8.7 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 8.7 At1g73960.1 68414.m08565 expressed protein similar to TATA bindi... 27 8.7 At1g13350.1 68414.m01550 protein kinase family protein contains ... 27 8.7 >At5g12230.1 68418.m01435 expressed protein Length = 221 Score = 36.7 bits (81), Expect = 0.008 Identities = 18/56 (32%), Positives = 33/56 (58%) Frame = +1 Query: 274 PPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 P ++ + RD++HK+ KD+ KD R+ KKH + +D+S ++ K DR++ Sbjct: 115 PSKSKSESKDRDRKHKKH-KDRDKDKDREHKKHKHKHKDRSKDKDKD--KDRDRKK 167 Score = 36.3 bits (80), Expect = 0.011 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 328 AKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDR---EEMAKDYYRENNTTG 480 +K + KD RK KKH RD+DK + K+ K DR ++ KD R+ + G Sbjct: 118 SKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNG 171 Score = 31.1 bits (67), Expect = 0.40 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 + K+HK KDK ++ + + KH R +DK R+ K + + D+ ++++ Sbjct: 128 KHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHH 183 >At5g57370.1 68418.m07168 expressed protein low similarity to nucleic acid binding protein [Homo sapiens] GI:431953 Length = 219 Score = 33.9 bits (74), Expect = 0.057 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 R RD+R R +D+ +D R+ + RDRD+ ++K+ +T D A+ Sbjct: 15 REPDRDRRRGRDDRDRDRDRDRERDRE--RDRDRGLRNKKSRSRTPDHHARAR 65 >At5g19480.1 68418.m02321 expressed protein Length = 207 Score = 33.9 bits (74), Expect = 0.057 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNTT 477 +D++H++ K KD K+ KH +DR K ++ K ++ D R+NN T Sbjct: 126 KDRKHRKHKDKKEKDREHKKHKHKHKDRIKDKDKDKDRDKKKEKSG-HHDKKRKNNGT 182 Score = 27.9 bits (59), Expect = 3.7 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNT 474 +D+ HK+ K K+KD + + K RD+ K + + ++ E A D R + Sbjct: 139 KDREHKKH-KHKHKDRIKDKDKDKDRDKKKEKSGHHDKKRKNNGTEDADDVQRHKKS 194 >At5g48610.1 68418.m06012 expressed protein ; expression supported by MPSS Length = 470 Score = 33.5 bits (73), Expect = 0.075 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNTT 477 ++K+ K +KDK K+ K+ KH + + K K + ++ E + +REN T Sbjct: 30 KEKKSKDRSKDKQKERKEKKDKHKDQKDKEKGKEKGKPLEEKKAELLTNAGHRENRVT 87 Score = 29.9 bits (64), Expect = 0.93 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +1 Query: 301 HRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 +++K+HK KDK K KEKK R +DK + K + K D+++ K Sbjct: 15 YKEKKHK---KDKEKREG-KEKKSKDRSKDKQKERKEKKDKHKDQKDKEK 60 Score = 27.1 bits (57), Expect = 6.5 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 319 KRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKD 453 K AKDK ++ +KE+K +K+ + K +LI+ EE KD Sbjct: 226 KTEAKDKDRNKEKKEEK--TESINKTRQEKPKLIRGPKLEEREKD 268 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 33.5 bits (73), Expect = 0.075 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 D K+ K Y D K+KK + D D K K D ++ K+Y+ + + Sbjct: 201 DYDEKKKKKKDYNDDDEKKKKKHYNDDDDEKKKKHNYNDDDDEKKKKKEYHDDED 255 Score = 31.5 bits (68), Expect = 0.30 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 301 HRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 + D K+ K D K+KKH + D D K K+E D+++ Sbjct: 212 YNDDDEKKKKKHYNDDDDEKKKKHNYNDDDDEKKKKKEYHDDEDKKK 258 >At3g23930.1 68416.m03006 expressed protein Length = 224 Score = 33.5 bits (73), Expect = 0.075 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +1 Query: 295 TTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE 438 T+ +++R RS K+ KD SR ++HL ++RD+ K +K ++RE Sbjct: 5 TSKQERRGVRSVKETSKDQSRG-RRHLIKERDEREKVMFLQLKEAERE 51 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 33.1 bits (72), Expect = 0.100 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 D+R +R K K ++ KE+K R++DK ++K + R+E K Sbjct: 128 DERRRRKRKRKEREEEEKERKRRRREKDKKKRNKSDKDGDKKRKEKKK 175 >At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28 {Saccharomyces cerevisiae}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 733 Score = 32.3 bits (70), Expect = 0.17 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 298 THRDKRHKRSA-KDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 T+RDK R +D+ +D R+ + RDRD+ R+ + DRE ++ RE Sbjct: 70 TNRDKDRDRDRDRDRERDRDRERDRGRDRDRDRDRDRDRDRERERDRERDRRERDRE 126 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 R RD+ R +D+ D +EK+ R+ + A+ K + K +RE+ Sbjct: 110 RERERDRERDRRERDREPDRRNREKE---REEEVKAREKARVEKLVEREK 156 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 32.3 bits (70), Expect = 0.17 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = +1 Query: 301 HRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNTTG 480 HR+ R KD+ +D R+E+K R+R+K + +RE + +E K+ R G Sbjct: 123 HREHERDRG-KDRKRDREREERKDKEREREKD-RERREREREEREKERVKERERREREDG 180 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKD 453 RDKR + +++ R K RDR++ + +E + DRE ++ Sbjct: 111 RDKRRVNEKERGHREHERDRGKDRKRDREREERKDKEREREKDRERRERE 160 >At1g65280.1 68414.m07402 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 598 Score = 31.5 bits (68), Expect = 0.30 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 R+KR KR + K K RKE+K RD K K+K+ ++ D + + Sbjct: 55 REKRRKREKERKRKKIERKERKR--RDMKKKKKTKKREYESDTESYSGSDSFSD 106 >At1g07840.2 68414.m00851 leucine zipper factor-related similar to charged amino acid rich leucine zipper factor-1 (GI:12061569) {Mus musculus} Length = 312 Score = 31.5 bits (68), Expect = 0.30 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 343 KDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYY 459 +D +RKEK H FR ++ K L DR E +DYY Sbjct: 188 RDAARKEK-HFFRQATENTYMKDVLDDLEDRPEEIRDYY 225 >At1g07840.1 68414.m00850 leucine zipper factor-related similar to charged amino acid rich leucine zipper factor-1 (GI:12061569) {Mus musculus} Length = 312 Score = 31.5 bits (68), Expect = 0.30 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 343 KDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYY 459 +D +RKEK H FR ++ K L DR E +DYY Sbjct: 188 RDAARKEK-HFFRQATENTYMKDVLDDLEDRPEEIRDYY 225 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 31.1 bits (67), Expect = 0.40 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTS-DRE-EMAKDYYRENN 471 D + KR ++D ++TSR + + + RDK + E+ + S DR+ E +K+ R+ + Sbjct: 34 DSKPKRESRDHERETSRSKDREREKGRDKDRERDSEVSRRSRDRDGEKSKERSRDKD 90 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 31.1 bits (67), Expect = 0.40 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTS-DRE-EMAKDYYRENN 471 D + KR ++D ++TSR + + + RDK + E+ + S DR+ E +K+ R+ + Sbjct: 34 DSKPKRESRDHERETSRSKDREREKGRDKDRERDSEVSRRSRDRDGEKSKERSRDKD 90 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 31.1 bits (67), Expect = 0.40 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTS-DRE-EMAKDYYRENN 471 D + KR ++D ++TSR + + + RDK + E+ + S DR+ E +K+ R+ + Sbjct: 34 DSKPKRESRDHERETSRSKDREREKGRDKDRERDSEVSRRSRDRDGEKSKERSRDKD 90 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 31.1 bits (67), Expect = 0.40 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 292 RTTHRDKRHKRS-AKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE 438 R + R + H RS ++D+ +D R ++H RDRD+ +E DRE Sbjct: 59 RRSKRSRSHHRSRSRDRERDRHRSSREH--RDRDREKDVDKEERNGKDRE 106 Score = 30.7 bits (66), Expect = 0.53 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 R+ R +RH+ ++K + KE++ RDRD+ +R K D+ E D R+ Sbjct: 127 RSRSRSERHRSQEREKSLEIEPKERETKDRDRDR----RRHKDKKEDKVEPEADPERDQR 182 Query: 472 T 474 T Sbjct: 183 T 183 Score = 28.7 bits (61), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEK----KHLFRDRDKSAKSKRELIKTSDRE 438 R RDK +D KD SR+ + +H ++R+KS + + + +T DR+ Sbjct: 105 RERDRDKDRDSKGRDHEKDRSRRSRSRSERHRSQEREKSLEIEPKERETKDRD 157 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNT 474 ++ K +D+ KD K + H +DR + ++S+ E ++ +RE+ + +E T Sbjct: 99 ERNGKDRERDRDKDRDSKGRDHE-KDRSRRSRSRSERHRSQEREKSLEIEPKERET 153 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 30.7 bits (66), Expect = 0.53 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = +1 Query: 295 TTHRDKRHKRSAK---DKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 T H+ +HK + K D K+TS KEKK +++S+ + R + K S + K+YY Sbjct: 5 TRHKSSKHKDATKEYSDSEKETSLKEKK----SKEESSTTVR-VSKESGSGDKRKEYYDS 59 Query: 466 NN 471 N Sbjct: 60 VN 61 Score = 29.5 bits (63), Expect = 1.2 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE-EMAKDYYRE 465 R RD+ R +D D R + RDR + E +T DRE + ++DYY + Sbjct: 336 RDRDRDRERDRDRRDYEHD--RYHDRDWDRDRSRDRDRDHERDRTHDREKDRSRDYYHD 392 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 R +RD + ++ ++ +R + RDRD+ RE + DR + D Y + + Sbjct: 303 RERNRDYDRESDRNERDRERTRDRDRDYERDRDRDRDRDRE--RDRDRRDYEHDRYHDRD 360 >At2g33435.1 68415.m04098 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 979 Score = 30.7 bits (66), Expect = 0.53 Identities = 13/48 (27%), Positives = 31/48 (64%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 D+ K S +++ KD+SRK+++ + R+++ +++ TS+R+ A+ Sbjct: 507 DRSKKLSREERVKDSSRKKEEAISSSREENLDKQKKDESTSNRKRKAE 554 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.7 bits (66), Expect = 0.53 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = +1 Query: 301 HRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 H D + R + D KD+S+ +K RDK R+ K DRE+ ++D RE + Sbjct: 31 HEDSK-SRESHDLKKDSSKISEKDNENGRDKDGNKDRDREKDRDREK-SRDRDREKS 85 Score = 29.9 bits (64), Expect = 0.93 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +1 Query: 271 KPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE 438 K + + + R K KD+ ++ R +K RDR+KS R+ ++ DR+ Sbjct: 44 KDSSKISEKDNENGRDKDGNKDRDREKDRDREKSRDRDREKSRDRDRDRERSKDRQ 99 >At5g57120.1 68418.m07132 expressed protein weak similarity to SP|Q14978 Nucleolar phosphoprotein p130 {Homo sapiens} Length = 330 Score = 30.3 bits (65), Expect = 0.70 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = +1 Query: 268 IKPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMA 447 +K AVI ++K+ K+S + KEK R R + ++K E T D +E + Sbjct: 140 VKETDAVIEDGVKEKKKKKSKSKSVEADDDKEKVSKKRKRSEPEETKEE---TEDDDEES 196 Query: 448 KDYYRENN 471 K +E N Sbjct: 197 KRRKKEEN 204 >At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 595 Score = 30.3 bits (65), Expect = 0.70 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 7/70 (10%) Frame = +1 Query: 289 IRTTHR-DKRHKRSAKDKYKDTSRKEKKHLFRDRD-----KSAKSK-RELIKTSDREEMA 447 + HR D+R R + ++ +R EKK + DRD +S K K + + + SD E Sbjct: 488 VEKEHRYDERRHRYVDMESENRNRSEKKPRYDDRDSEKHHRSVKGKEKHVYEASDDPEEF 547 Query: 448 KDYYRENNTT 477 D YR T Sbjct: 548 SDRYRSTKKT 557 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 29.9 bits (64), Expect = 0.93 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 304 RDKRHKRSAKDK-YKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 +DK ++ K+K KD KEKK +++K K ++E K E+ KD R+ Sbjct: 59 KDKEQEKKDKEKAAKDKKEKEKKDK-EEKEKKDKERKEKEKKDKLEKEKKDKERK 112 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 ++K+ K + + KD KEKK R + + +R+ + D+EE Sbjct: 86 KEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKERKAKEKKDKEE 131 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 29.9 bits (64), Expect = 0.93 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = +1 Query: 301 HRDKRHKRS---AKDKYKDTSR---KEKKHLFRDRDKSAKSKRELIKTSDRE-EMAKDYY 459 HRD R K +KDK KD R ++K H RD++K KR + +++E +D Sbjct: 27 HRDGRRKEKDHRSKDKEKDYDREKIRDKDHR-RDKEKERDRKRSRDEDTEKEISRGRDKE 85 Query: 460 RENN 471 RE + Sbjct: 86 REKD 89 Score = 29.9 bits (64), Expect = 0.93 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 6/61 (9%) Frame = +1 Query: 304 RDKRHKRSA-KDKYKDTSRKE--KKHLFRDRDKSAKS--KRELIKTSDRE-EMAKDYYRE 465 RDK H+R K++ + SR E +K + R RDK + R+ +K D+E E + RE Sbjct: 52 RDKDHRRDKEKERDRKRSRDEDTEKEISRGRDKEREKDKSRDRVKEKDKEKERNRHKDRE 111 Query: 466 N 468 N Sbjct: 112 N 112 Score = 27.1 bits (57), Expect = 6.5 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 337 KYKDTSRKEKKHLFRDRDKSAKSKRELIKTSD-REEMAKDYYRENN 471 +++D RKEK H R +DK RE I+ D R + K+ R+ + Sbjct: 26 EHRDGRRKEKDH--RSKDKEKDYDREKIRDKDHRRDKEKERDRKRS 69 >At2g41960.1 68415.m05191 expressed protein Length = 1215 Score = 29.9 bits (64), Expect = 0.93 Identities = 14/56 (25%), Positives = 34/56 (60%) Frame = +1 Query: 286 VIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKD 453 ++ ++K + K+K ++ RKE+K + ++R+K + ++E +K +RE+ K+ Sbjct: 491 IVTLEKQNKLLEEEEKEKREEEERKERKRI-KEREKKLR-RKERLKEKEREKEQKN 544 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKD 453 R HR R K +DK ++ SR ++ R+R + + + K DRE ++ Sbjct: 77 RERHRSSRDKDRERDKVREGSRDKESD--RERSSKERDRSDRDKPRDRERRERE 128 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +1 Query: 310 KRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 K RS +DK +D R+E++ R + + + E+++ R K Sbjct: 109 KERDRSDRDKPRDRERREREKRSSSRSRREEKEPEVVERGSRRHRDK 155 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 29.5 bits (63), Expect = 1.2 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +1 Query: 268 IKPPQAVIRTTH-RDKRHKRS-AKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 + P + ++H R K+ KRS KDK++ + +++K+H + + + KR+ ++ D E Sbjct: 230 LSSPSFLSSSSHERQKKRKRSSKKDKHRRSKQRDKRHEKKRSMRDKRPKRKSRRSPDSLE 289 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 29.5 bits (63), Expect = 1.2 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 289 IRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYREN 468 IR KR + AK + ++ +KE++ + R + + KRE REE + RE+ Sbjct: 595 IREEQERKREEEMAKRREQERQKKEREEMERKKREEEARKREEEMAKIREEERQRKERED 654 Score = 28.3 bits (60), Expect = 2.8 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 280 QAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 QA R R+K + AK + ++ RKE++ + R R + + KR + REE K Sbjct: 515 QARKREEEREKEEEM-AKKREEERQRKEREEVERKRREEQERKRREEEARKREEERK 570 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 304 RDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 R R ++ K + + R+E++ ++R++ + KRE EEMAK Sbjct: 593 RKIREEQERKREEEMAKRREQERQKKEREEMERKKREEEARKREEEMAK 641 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 310 KRHKRSAKDKYKDTSRKEKKHLFRD--RDKSAKSKRELIKTSDREEMAKD 453 KR + AK + ++ RKE++ + R ++ K + E+ K ++E K+ Sbjct: 570 KREEEMAKRREQERQRKEREEVERKIREEQERKREEEMAKRREQERQKKE 619 >At3g53640.1 68416.m05925 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 642 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +1 Query: 268 IKPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMA 447 +K ++ R ++RD RS++DK + +SR+ + R+R K R + +E+ Sbjct: 74 LKKKGSIDRESNRDNYRGRSSRDKARSSSRETGRENERERRKDQDRDRGRREDQSDQEIY 133 Query: 448 K 450 K Sbjct: 134 K 134 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 301 HRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 +R+K+ K K K+ ++KEKK +D+ + K E ++EE Sbjct: 1009 NREKKEYEEKKSKTKEEAKKEKKK-SQDKKREEKDSEERKSKKEKEE 1054 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKD 453 R + ++K R K K K+ KEKK + K + K+E D + M K+ Sbjct: 1046 RKSKKEKEESRDLKAKKKEEETKEKKESENHKSKKKEDKKE---HEDNKSMKKE 1096 Score = 27.1 bits (57), Expect = 6.5 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 DK+ K+S+KD+ K +KEK+ + K K++ + K + EE K Sbjct: 1179 DKKEKKSSKDQQK---KKEKEMKESEEKKLKKNEEDRKKQTSVEENKK 1223 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/52 (23%), Positives = 27/52 (51%) Frame = +1 Query: 322 RSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNTT 477 + +D K+T++ E L ++ +K K K+E ++ + K+Y + + T Sbjct: 972 KKQEDNKKETTKSENSKL-KEENKDNKEKKESEDSASKNREKKEYEEKKSKT 1022 >At1g69070.1 68414.m07903 expressed protein Length = 901 Score = 29.1 bits (62), Expect = 1.6 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 152 MSNYEDDQSEDGELARSPIHDEMDFS-LSDED 244 +S+ E+D EDG L S + D+ D LSDED Sbjct: 126 LSDGEEDVYEDGALGGSSVKDDFDSGLLSDED 157 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/58 (22%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 289 IRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKS-AKSKRELIKTSDREEMAKDYY 459 + H R++ KD+++ +E++ +R+K + K E K +RE+M ++ + Sbjct: 122 VEREHEGDRNRAKEKDRHEKQKEREREREKLEREKEREREKIEREKEREREKMEREIF 179 >At5g27860.1 68418.m03342 expressed protein Length = 177 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 298 THRDKRHKR--SAKDKYKDTSRKEKKHLFRDRDK 393 + R K+H++ AKDK + S + K+H R+R K Sbjct: 81 SRRHKKHEKPKKAKDKERSKSHRHKRHKNRERKK 114 >At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 4706 Score = 28.7 bits (61), Expect = 2.1 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = -2 Query: 365 FSFLDVSLYLSFADLLWRLSLCVVLITA*GGLIISASGYLC-LRQIN*NPFRRV*DSVLI 189 F+F SLYL F ++L L L VL A I+S LC R++N N R V + I Sbjct: 4146 FAFELPSLYLPFLNILKDLGLNDVLSVAAAKDILSKLQKLCGYRRLNPNELRAV---MEI 4202 Query: 188 LHLHFDRLH 162 LH D ++ Sbjct: 4203 LHFLCDEIN 4211 >At5g37370.2 68418.m04490 pre-mRNA splicing factor PRP38 family protein (SRL1) contains Pfam profile PF03371: PRP38 family Length = 385 Score = 28.3 bits (60), Expect = 2.8 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 316 HKRSAKDKYKDTS--RKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 + R+ D+ + S R + + + DRD + +RE K +RE +D YRE Sbjct: 224 YDRNGGDEVQQRSPRRSQSRDYYSDRDSDRQREREREKDRERER-GRDRYRE 274 >At5g37370.1 68418.m04489 pre-mRNA splicing factor PRP38 family protein (SRL1) contains Pfam profile PF03371: PRP38 family Length = 393 Score = 28.3 bits (60), Expect = 2.8 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 316 HKRSAKDKYKDTS--RKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 + R+ D+ + S R + + + DRD + +RE K +RE +D YRE Sbjct: 232 YDRNGGDEVQQRSPRRSQSRDYYSDRDSDRQREREREKDRERER-GRDRYRE 282 >At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 930 Score = 28.3 bits (60), Expect = 2.8 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 307 DKRHKR-SAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 ++R KR + KD++++ S + + RDK R + S RE+ Sbjct: 846 ERRRKRYNKKDRHRNDSESDSSSDYHSRDKQGSRSRSKRRESSREK 891 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/65 (21%), Positives = 31/65 (47%) Frame = +1 Query: 277 PQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDY 456 P+ R R+ +H R +D R ++ R RD+ + +R+ + R+ ++D+ Sbjct: 286 PRERSRDRPREDKHHRDRDQGGRDRDRDSRRDRDRTRDRGDRDRRD--RDRGRDRTSRDH 343 Query: 457 YRENN 471 R+ + Sbjct: 344 DRDRS 348 >At5g05570.1 68418.m00605 transducin family protein / WD-40 repeat family protein similar to unknown protein (pir||T04661); contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 2 weak)|8683726|gb|AV524198.1|AV524198 Length = 1124 Score = 27.5 bits (58), Expect = 5.0 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +1 Query: 256 DALIIKPPQAVIRTTHRDKRHK---RSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKT 426 D + I P ++ T +DK+ K R+ K+K D + + + R D+ R+ +T Sbjct: 1011 DDIEIDEPVIILPLTEKDKKEKKDKRTDKEKLFDGASSDAQPKTRTVDEIKSKYRKAGET 1070 Query: 427 SDREEMAKDYYRE 465 S AKD E Sbjct: 1071 SAIASQAKDKLHE 1083 >At4g01560.1 68417.m00202 brix domain-containing protein contains Pfam domain, PF04427: Brix domain Length = 343 Score = 27.5 bits (58), Expect = 5.0 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 301 HRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKREL 417 ++DKR K AK K++ K+KK R RD + K EL Sbjct: 41 NKDKRSKVYAKQKHEKKLEKQKK--IRARDAAEKRALEL 77 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 27.5 bits (58), Expect = 5.0 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 R+ R+K+ ++ + K KD +++K D+D S RE E++ Y NN Sbjct: 550 RSKEREKKLRKKERLKEKDKGKEKKNPECSDKDMLLNSSRE------EEDLPNLYDETNN 603 Query: 472 T 474 T Sbjct: 604 T 604 Score = 27.1 bits (57), Expect = 6.5 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = +1 Query: 286 VIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKD 453 +I + K + K+K ++ RKEKK ++R+K + K+E +K D+ + K+ Sbjct: 522 IITLEKQVKLLEEEEKEKREEEERKEKKR-SKEREKKLR-KKERLKEKDKGKEKKN 575 >At3g26560.1 68416.m03315 ATP-dependent RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00575: S1 RNA binding domain Length = 1168 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDR 435 R RD+R +D+ ++ R +++ RDR+++ + + SDR Sbjct: 127 RNRDRDRRESGRDRDRDRNRDRDDRRDRHRDRERNRGDEEGEDRRSDR 174 >At3g13980.1 68416.m01765 expressed protein Length = 357 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 352 SRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENNTT 477 S K+KKH + R+ S RE+ R +A D+ R T Sbjct: 42 SIKKKKHHHQQRNASLHEDREISPIYHRRSIAADFERSRRKT 83 >At2g40650.1 68415.m05016 pre-mRNA splicing factor PRP38 family protein contains Pfam profile PF03371: PRP38 family Length = 355 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRD 390 D+R K +++ +D R+ H RDRD Sbjct: 209 DQRRKSPERERERDRDRRRDSHRHRDRD 236 Score = 27.5 bits (58), Expect = 5.0 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 R RD+ +R + +++D + RD D+ + +R + DRE +D+YRE + Sbjct: 217 RERERDRDRRRDSH-RHRDRDYDRDYDMDRDHDRDYERERGHGRDRDRER-DRDHYRERD 274 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.1 bits (57), Expect = 6.5 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = +1 Query: 211 RRNGFQFI*RRQR*PDALIIKPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFR--D 384 RR+ + R QR D K Q + D+ + + DK SRK KH R Sbjct: 613 RRSKRNYRSRSQRDEDG---KMEQGEEEESSMDEVTEETKTDKKHSCSRKRHKHKTRYSS 669 Query: 385 RDKSAKSKRELIKTSDREEMAKDYYRENNT 474 +D+ ++ K + +SD E ++ +R ++ Sbjct: 670 KDRHSRDKHKHESSSDDEYHSRSRHRHRHS 699 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.1 bits (57), Expect = 6.5 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = +1 Query: 211 RRNGFQFI*RRQR*PDALIIKPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFR--D 384 RR+ + R QR D K Q + D+ + + DK SRK KH R Sbjct: 613 RRSKRNYRSRSQRDEDG---KMEQGEEEESSMDEVTEETKTDKKHSCSRKRHKHKTRYSS 669 Query: 385 RDKSAKSKRELIKTSDREEMAKDYYRENNT 474 +D+ ++ K + +SD E ++ +R ++ Sbjct: 670 KDRHSRDKHKHESSSDDEYHSRSRHRHRHS 699 >At5g44310.2 68418.m05424 late embryogenesis abundant domain-containing protein / LEA domain-containing protein low similarity to 51 kDa seed maturation protein [Glycine max] GI:414977; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 331 Score = 27.1 bits (57), Expect = 6.5 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +1 Query: 271 KPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDK-SAKSKRELIKTSDREEMA 447 K + R + K AKDK D K K + +DK + + R K + +E A Sbjct: 114 KVNEGASRAADKAYETKEKAKDKAYDVKEKTKDYAEEAKDKVNEGASRAADKAYETKEKA 173 Query: 448 KD 453 KD Sbjct: 174 KD 175 >At5g44310.1 68418.m05423 late embryogenesis abundant domain-containing protein / LEA domain-containing protein low similarity to 51 kDa seed maturation protein [Glycine max] GI:414977; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 295 Score = 27.1 bits (57), Expect = 6.5 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +1 Query: 271 KPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDK-SAKSKRELIKTSDREEMA 447 K + R + K AKDK D K K + +DK + + R K + +E A Sbjct: 78 KVNEGASRAADKAYETKEKAKDKAYDVKEKTKDYAEEAKDKVNEGASRAADKAYETKEKA 137 Query: 448 KD 453 KD Sbjct: 138 KD 139 >At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative similar to GT-2 factor [Arabidopsis thaliana GI:416490 Length = 619 Score = 27.1 bits (57), Expect = 6.5 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = +2 Query: 152 MSNYEDDQSEDGELARSPIHDEMDFSLSDEDRDNQMR*LSSLLKQ*SEPHTGTSATRDLQ 331 +S + D + + SP D +L + + SSLL Q PH + + L+ Sbjct: 372 ISKFTDHDLDVVQNPTSPSQDSSSLALRKTQGRRKFQTSSSLLPQTLTPHNLLTIDKSLE 431 Query: 332 KINTKTHLEKKRS 370 +TKT K ++ Sbjct: 432 PFSTKTLKPKNQN 444 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 27.1 bits (57), Expect = 6.5 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 DK+ K+ K++ + +KEKK R+ K S++ K +E+ AK Sbjct: 46 DKKDKKDKKERKEKKEKKEKKRKERE-GKEVGSEKRSHKRRRKEDGAK 92 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 27.1 bits (57), Expect = 6.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 310 KRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE 438 K +R K+K KD KE++ R+R+K +R + SD E Sbjct: 808 KEKERDEKEKRKDKD-KERREKEREREKEKGKERSKREESDGE 849 >At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family protein / snRNP family protein contains similarity to U4/U6 small nuclear ribonucleoprotein hPrp3 [Homo sapiens] gi|2708307|gb|AAC51926 Length = 786 Score = 27.1 bits (57), Expect = 6.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +1 Query: 292 RTTHRDK---RHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 R RD+ R RS + ++ SR +KH + +K K K DREE Sbjct: 54 REDERDRTKDRRGRSVERGEREGSRDREKHHHERSHEGSKEKESRSKRKDREE 106 >At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related similar to U2 small nuclear ribonucleoprotein auxiliary factor 35 kD subunit related protein 1 (sp|Q15695) Length = 757 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 322 RSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE 438 +S KD+ + R+ K + D+S K KR+ + SDRE Sbjct: 680 QSDKDRDRSKQRQRYKSDDPESDQSRKGKRQSEENSDRE 718 >At1g08450.2 68414.m00935 calreticulin 3 (CRT3) identical to similar to SP|O04153 Calreticulin 3 precursor {Arabidopsis thaliana} Length = 370 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 D + RS D Y R+ +K LF + +K K++ + REE Sbjct: 291 DPAYARSIVDDYFAQHRESEKELFAEAEKERKAREDEEARIAREE 335 >At1g08450.1 68414.m00934 calreticulin 3 (CRT3) identical to similar to SP|O04153 Calreticulin 3 precursor {Arabidopsis thaliana} Length = 424 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREE 441 D + RS D Y R+ +K LF + +K K++ + REE Sbjct: 345 DPAYARSIVDDYFAQHRESEKELFAEAEKERKAREDEEARIAREE 389 >At5g05210.1 68418.m00555 nucleolar matrix protein-related contains Pfam domain, PF04935: Surfeit locus protein 6 Length = 386 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/58 (18%), Positives = 31/58 (53%) Frame = +1 Query: 277 PQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 P+ + ++ H+DK+ + +K+K+ ++K + K + + + I+ + ++AK Sbjct: 306 PKLLKQSIHKDKKRQEKNAEKWKERIEGQQKFKVEKQQKRSGNIADRIEQNKMRKIAK 363 >At4g14350.2 68417.m02211 protein kinase family protein contains similarity to Swiss-Prot:O13310 serine/threonine-protein kinase orb6 [Schizosaccharomyces pombe] Length = 551 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 319 KRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 K +KDK K + +KE ++ K+A + L + + A Y EN+ Sbjct: 10 KLKSKDKVKSSKKKEATSNVKEGPKTAGGEEALSNITKEKAAAAKLYIENH 60 >At4g14350.1 68417.m02210 protein kinase family protein contains similarity to Swiss-Prot:O13310 serine/threonine-protein kinase orb6 [Schizosaccharomyces pombe] Length = 551 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 319 KRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRENN 471 K +KDK K + +KE ++ K+A + L + + A Y EN+ Sbjct: 10 KLKSKDKVKSSKKKEATSNVKEGPKTAGGEEALSNITKEKAAAAKLYIENH 60 >At3g51640.1 68416.m05663 expressed protein Length = 826 Score = 26.6 bits (56), Expect = 8.7 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 307 DKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAKDYYRE 465 +K K S K KDT EKK R +++ S + SD EE+ K +E Sbjct: 301 EKCSKLSVAAKEKDTKEAEKKRQERRKERDRASSK---SNSDGEEVDKRTRKE 350 >At2g27285.1 68415.m03279 expressed protein weak similarity to maebl (GI:20087019) [Plasmodium falciparum], chimeric erythrocyte-binding protein MAEBL (GI:22086284) [Plasmodium falciparum] Length = 323 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/66 (22%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 268 IKPPQAVIRTTHRDKRHKRSAKDKYKDTSRKEKKH-LFRDRDKSAKSKRELIKTSDREEM 444 +K + R R++R R ++ K R+EK+H + +R + + +++ SD+E+ Sbjct: 78 MKQKAVLPRMQDREERKPRYIQNLMKQAERREKEHEIVYERKLAKEREKDEHLFSDKEKF 137 Query: 445 AKDYYR 462 Y+ Sbjct: 138 VTGAYK 143 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +1 Query: 310 KRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDRE 438 +R + A+DK ++ R E++H DR++ + +RE + DRE Sbjct: 361 RREDQRARDKERERER-EREH---DRERERQRERERQRARDRE 399 >At1g73960.1 68414.m08565 expressed protein similar to TATA binding protein associated factor (GI:2827282) [Homo sapiens]; similar to Transcription initiation factor TFIID 150 kDa subunit (TAFII-150) (TAFII150) (Swiss-Prot:Q24325) [Drosophila melanogaster] Length = 1390 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 331 KDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 K+K KD +KEKK D K + + K +EMAK Sbjct: 1289 KEKKKDKEKKEKKRKREDPVYLEKKRLKKEKKRKEKEMAK 1328 >At1g13350.1 68414.m01550 protein kinase family protein contains protein kinase domain, Pfam:PF00069 (likely that this cDNA contains a single unspliced intron. Putative intron removed in this gene model.) Length = 761 Score = 26.6 bits (56), Expect = 8.7 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 292 RTTHRDKRHKRSAKDKYKDTSRKEKKHLFRDRDKSAKSKRELIKTSDREEMAK 450 R R + S D+ KD R R RDK+ S RE + ++RE ++ Sbjct: 125 RRKERGSVDRDSRGDREKDYLRDRDNDRGRSRDKARYSSRERGRENERERRSE 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,014,990 Number of Sequences: 28952 Number of extensions: 136625 Number of successful extensions: 762 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 819227264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -