BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0105 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 25 0.70 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 25 0.70 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.1 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 22 4.9 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.9 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.0 bits (52), Expect = 0.70 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 66 IVNIRTSVHRSTRMHRTSYPLDHDDFKLVMAAYNY 170 + +IR S+ S M+ YPLD L MA+Y + Sbjct: 149 LYSIRISLTLSCPMNLKLYPLDRQVCSLRMASYGW 183 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.0 bits (52), Expect = 0.70 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 66 IVNIRTSVHRSTRMHRTSYPLDHDDFKLVMAAYNY 170 + +IR S+ S M+ YPLD L MA+Y + Sbjct: 149 LYSIRISLTLSCPMNLKLYPLDRQVCSLRMASYGW 183 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 461 IKYIKDTKTLSINFMIVFDFS 523 IKY K T+ NFM + D + Sbjct: 301 IKYYKSGSTVPFNFMFIADLN 321 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +3 Query: 141 FKLVMAAYNYAYGSRKTLLTVVSVVCRLR 227 F+L ++ S+KT++ ++ VC L+ Sbjct: 12 FRLSKVMLDHTINSKKTIMRILKEVCVLQ 40 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +1 Query: 238 NNS*TWADANHTVKHVFIKYLYSYISYPLPTIVFFRSF 351 NN + + N+ K + Y+ + P+P V++ +F Sbjct: 101 NNKYNYNNNNYNKKLYYKNYIINIEQIPVPVPVYYGNF 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,392 Number of Sequences: 438 Number of extensions: 4009 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -