BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0103 (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22720.1 68418.m02654 F-box family protein contains F-box dom... 28 7.5 At1g11960.1 68414.m01382 early-responsive to dehydration protein... 27 9.9 >At5g22720.1 68418.m02654 F-box family protein contains F-box domain Pfam:PF00646 Length = 422 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 543 DKEVSLQKKNLLHNSLKLVSFTWDIKNSKAIKSG 644 D EV LQK++++HN +S D+K S +G Sbjct: 287 DDEVDLQKRDMVHNFFTSISGVSDMKISSQAFAG 320 >At1g11960.1 68414.m01382 early-responsive to dehydration protein-related / ERD protein-related low similarity to ERD4 protein [Arabidopsis thaliana] GI:15375406 Length = 375 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 718 VQIMNDRLYYFGYYISIIKQSYLHEPLLIA 629 +Q NDR+Y+ +Y+ I+ S LH L++ Sbjct: 30 IQPFNDRVYFPKWYLKGIRSSPLHSGALVS 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,418,620 Number of Sequences: 28952 Number of extensions: 244944 Number of successful extensions: 465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -