BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0101 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 24 1.7 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 24 1.7 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.3 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 7.0 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 9.2 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 301 VPPTHATLPVPHWR 260 VPP ++ L PHWR Sbjct: 34 VPPEYSDLVRPHWR 47 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 301 VPPTHATLPVPHWR 260 VPP ++ L PHWR Sbjct: 34 VPPEYSDLVHPHWR 47 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 26 SCVIASLY*STNGSQRINSFPHRGPEVLVFEGFRFKRKQC 145 SCVIAS + + ++ N P R + + R +R +C Sbjct: 222 SCVIASRHRNLEATESENVRPRRNVLIERAKSIRARRTEC 261 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 546 HQAGSIFRSGRVRTL*REHSTGECAGQ 466 H A I+R+G V L R H C G+ Sbjct: 163 HFALRIYRNGTVNYLMRRHLILSCQGR 189 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 546 HQAGSIFRSGRVRTL*REHSTGECAGQ 466 H A I+R+G V L R H C G+ Sbjct: 163 HFALRIYRNGTVNYLMRRHLILSCQGR 189 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 546 HQAGSIFRSGRVRTL*REHSTGECAGQ 466 H A I+R+G V L R H C G+ Sbjct: 214 HFALRIYRNGTVNYLMRRHLILSCQGR 240 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 546 HQAGSIFRSGRVRTL*REHSTGECAGQ 466 H A I+R+G V L R H C G+ Sbjct: 163 HFALRIYRNGTVNYLMRRHLILSCQGR 189 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 595 HPKTATGKLKAVMMPTTPSGFHFSI 521 H T +A + P TP F+FS+ Sbjct: 288 HTSTPNFLSEAKIFPPTPGSFNFSM 312 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 319 LLQARAVPPTHATLPV 272 LL A +PPT T+P+ Sbjct: 283 LLLAEIIPPTSLTVPL 298 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,938 Number of Sequences: 438 Number of extensions: 4567 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -