BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0099 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71177-5|CAA94871.2| 531|Caenorhabditis elegans Hypothetical pr... 31 1.0 Z71177-4|CAA94870.1| 529|Caenorhabditis elegans Hypothetical pr... 29 4.2 >Z71177-5|CAA94871.2| 531|Caenorhabditis elegans Hypothetical protein AC3.8 protein. Length = 531 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +1 Query: 109 YCVHYQFIRYYKVKSHTVYII-LLS*IYKNELL 204 Y VHY FI+YY + ++ + II LS +Y L+ Sbjct: 483 YSVHYNFIKYYMLDAYAIIIIFFLSILYVLNLI 515 >Z71177-4|CAA94870.1| 529|Caenorhabditis elegans Hypothetical protein AC3.7 protein. Length = 529 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 109 YCVHYQFIRYYKVKSHT-VYIILLS*IYKNELLFASLAK 222 Y VHY F++YY + + ++ IL+ Y LLF + K Sbjct: 481 YNVHYNFVQYYMLDAFAIIFSILIIIFYLAHLLFKFVYK 519 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,334,556 Number of Sequences: 27780 Number of extensions: 244571 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -