BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0097 (791 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27700.2 68416.m03459 RNA recognition motif (RRM)-containing ... 29 2.7 At3g27700.1 68416.m03458 RNA recognition motif (RRM)-containing ... 29 2.7 At5g08720.1 68418.m01036 expressed protein 29 3.5 At5g06100.2 68418.m00678 myb family transcription factor (MYB33)... 29 3.5 At5g06100.1 68418.m00677 myb family transcription factor (MYB33)... 29 3.5 At1g69820.1 68414.m08033 gamma-glutamyltranspeptidase family pro... 29 4.7 At1g11800.1 68414.m01354 endonuclease/exonuclease/phosphatase fa... 28 6.2 At4g11850.1 68417.m01886 phospholipase D gamma 1 / PLD gamma 1 (... 28 8.2 >At3g27700.2 68416.m03459 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 908 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 372 FKKGSGKTVDFDEQKMRKEYICGASGGRGHG 464 F GSG+ V FD Q+MR + G G G Sbjct: 85 FGTGSGQRVQFDNQRMRSNPMFSRDSGPGRG 115 >At3g27700.1 68416.m03458 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 908 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 372 FKKGSGKTVDFDEQKMRKEYICGASGGRGHG 464 F GSG+ V FD Q+MR + G G G Sbjct: 85 FGTGSGQRVQFDNQRMRSNPMFSRDSGPGRG 115 >At5g08720.1 68418.m01036 expressed protein Length = 719 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 409 SRKCVRSTSVARVVGGGMARCRGTR-LGTGGSPD 507 SR V S+ +GGG+A+C GTR G GG D Sbjct: 33 SRIRVFSSISTSGIGGGVAKCHGTRHSGAGGRGD 66 >At5g06100.2 68418.m00678 myb family transcription factor (MYB33) contains Pfam profile: PF00249 myb DNA-binding domain Length = 520 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 86 GCSRGNCQYWSRPR*PRNSSLAYPEPSALTTTCSMKTPMPVMHP 217 GCS Q +S P RN+S P ++ TCS P V HP Sbjct: 241 GCSSTIKQEFSSPEQFRNTS-----PQTISKTCSFSVPCDVEHP 279 >At5g06100.1 68418.m00677 myb family transcription factor (MYB33) contains Pfam profile: PF00249 myb DNA-binding domain Length = 451 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 86 GCSRGNCQYWSRPR*PRNSSLAYPEPSALTTTCSMKTPMPVMHP 217 GCS Q +S P RN+S P ++ TCS P V HP Sbjct: 241 GCSSTIKQEFSSPEQFRNTS-----PQTISKTCSFSVPCDVEHP 279 >At1g69820.1 68414.m08033 gamma-glutamyltranspeptidase family protein similar to SP|P19440 Gamma-glutamyltranspeptidase 1 precursor (EC 2.3.2.2) (Gamma-glutamyltransferase 1) (CD224 antigen) {Homo sapiens}; contains Pfam profilePF01019: Gamma-glutamyltranspeptidase Length = 191 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +3 Query: 276 ILVEKVQDFYIKINQTINITVSPSQPKYYFYPFKKG-SGKTVDFDEQKMRKEYICGASGG 452 +L ++ DF I + + N+TV P P + P K+ S T + + + GASGG Sbjct: 89 VLNNEMDDFSIPMKSSSNLTVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKASVGASGG 148 >At1g11800.1 68414.m01354 endonuclease/exonuclease/phosphatase family protein contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 441 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -2 Query: 523 DYDVLGRESHPYPTSFLCTSPCPLPPLAPQMYS 425 + +V GR+ + TS L SPCP PP QM+S Sbjct: 274 EVEVPGRKPLVFATSHL-ESPCPGPPKWDQMFS 305 >At4g11850.1 68417.m01886 phospholipase D gamma 1 / PLD gamma 1 (PLDGAMMA1) identical to phospholipase D gamma 1 SP:Q9T053 from [Arabidopsis thaliana] Length = 858 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 432 ICGASGGRGHGEVQRNEVG 488 +C SGG+GH ++++EVG Sbjct: 345 LCPRSGGKGHSFIKKSEVG 363 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,914,441 Number of Sequences: 28952 Number of extensions: 394098 Number of successful extensions: 1176 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -