BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0093 (856 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 2.3 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 7.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.4 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 47 ISYPDKYYEFESVYR 91 + P+KYYE + VYR Sbjct: 772 VPIPNKYYEAKQVYR 786 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 128 ILSLVSSIHNCAANATKYANSV 193 +L +V +HN N + ANS+ Sbjct: 210 LLDIVHGVHNELCNLCQVANSI 231 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 3 SEQTAGPRIFRALEILVTLTSTTNLNQYTEK 95 SEQ G + ++ TL +T +N Y K Sbjct: 375 SEQQWGILVLIIAPLIATLIATVTVNYYRHK 405 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,079 Number of Sequences: 336 Number of extensions: 3951 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -