BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0092 (793 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces p... 28 1.3 SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 3.1 >SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 28.3 bits (60), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 396 QADIWQWVPRWWKYCYYDFFKGI 328 + D+W W P K Y+FF GI Sbjct: 299 RGDVWDWNPNLIKVVPYEFFVGI 321 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 27.1 bits (57), Expect = 3.1 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 199 PSAARVISTNSPRCWSVVNPLHILLRYDSHDTARCGHSM 83 PS A I+ +CW + N +LLR D+ GHS+ Sbjct: 185 PSDAPYITKGLTQCWRLANATTLLLRKAEKDSR--GHSL 221 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,519,172 Number of Sequences: 5004 Number of extensions: 75646 Number of successful extensions: 133 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -