BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0092 (793 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 57 2e-10 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 41 2e-05 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 34 0.001 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 26 0.46 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.5 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 3.3 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 22 7.5 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 7.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 7.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 7.5 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 9.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 9.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 9.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.9 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 56.8 bits (131), Expect = 2e-10 Identities = 24/59 (40%), Positives = 36/59 (61%) Frame = +3 Query: 84 MECPHLAVSWESYRSSICNGLTTLQQRGEFVDMTLAADGHLVKVHRMVLCLVSPYIKPL 260 ++ H + W +Y+SSI + L+ +FVD+TLA DG +K HR+VL SPY + L Sbjct: 2 VDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACDGRSLKAHRVVLSACSPYFREL 60 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 40.7 bits (91), Expect = 2e-05 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +3 Query: 96 HLAVSWESYRSSICNGLTTLQQRGEFVDMTLAADGHLVKVHRMVLCLVSPYIKPL 260 H + W +Y+S++ + L Q FVD+TLA + +K H++VL S Y + L Sbjct: 10 HYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNEASLKAHKVVLSACSSYFQKL 64 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 34.3 bits (75), Expect = 0.001 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 84 MECPHLAVSWESYRSSICNGLTTLQQRGEFVDMTLAAD 197 ++ H + W +Y+SSI + L+ +FVD+TLA + Sbjct: 2 VDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.8 bits (54), Expect = 0.46 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 316 NIIPYIKEYNWVWTIYRGY 260 N +PY++E++W Y GY Sbjct: 277 NDLPYLEEFDWQKPFYPGY 295 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.4 bits (48), Expect = 2.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 138 NGLTTLQQRGEFVDMTLAAD 197 NG++ L + E+VD+T+ D Sbjct: 396 NGVSALAGKSEYVDITVTTD 415 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +3 Query: 45 QHLNIVSYC*LINMECPHLAVSWESYRSSICNGLTTLQQRGEF 173 Q +N+ L CP +A+S S LT +++ GEF Sbjct: 189 QSINLCMAGRLFGYLCPGMALSQFDLMGSPYRNLTFVRREGEF 231 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.8 bits (44), Expect = 7.5 Identities = 4/15 (26%), Positives = 13/15 (86%) Frame = -3 Query: 215 YFHQMSISCKGHIHK 171 +FH+++++C+ +H+ Sbjct: 109 FFHKIALTCEDDVHR 123 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 363 WKYCYYDFFKGIKHQSTL 310 WKY YDF K Q+ + Sbjct: 35 WKYIDYDFGSDEKRQAAI 52 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 363 WKYCYYDFFKGIKHQSTL 310 WKY YDF K Q+ + Sbjct: 41 WKYIDYDFGSDEKRQAAI 58 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 Query: 110 VGIVSK*YMQRIDHTPAAWRVCG 178 V +V + +R+DH W CG Sbjct: 505 VKLVDFGFAKRLDHGRKTWTFCG 527 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 97 NYNNYNKHNY 106 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 330 NYNNYNKHNY 339 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 664 NLQNYNLHNY 693 N NYN HNY Sbjct: 330 NYNNYNKHNY 339 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 363 WKYCYYDFFKGIK 325 W CY+ +KG+K Sbjct: 184 WILCYFCIWKGVK 196 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 363 WKYCYYDFFKGIK 325 W CY+ +KG+K Sbjct: 217 WIMCYFCIWKGVK 229 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 363 WKYCYYDFFKGIK 325 W CY+ +KG+K Sbjct: 270 WIMCYFCIWKGVK 282 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 450 AVTGFCNFYSL*SINNQ 500 ++ F +FYS SINNQ Sbjct: 793 SMPNFADFYSEESINNQ 809 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,179 Number of Sequences: 438 Number of extensions: 5657 Number of successful extensions: 30 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -