BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0090 (355 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20928| Best HMM Match : NHL (HMM E-Value=0) 29 1.4 SB_44513| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-08) 26 7.7 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 28.7 bits (61), Expect = 1.4 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 161 CNSFYCTSKM*AHARLSXTINT*KIMSFIE 72 CN F C S + AH R+ T + +IMSFIE Sbjct: 127 CNEFLCDSCVRAHQRVRLTKDH-RIMSFIE 155 >SB_44513| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-08) Length = 573 Score = 26.2 bits (55), Expect = 7.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 36 FERHSFLPLYYVFNKRHY 89 F+R FLPLYY N H+ Sbjct: 391 FQRFRFLPLYYSINGVHH 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,398,611 Number of Sequences: 59808 Number of extensions: 174638 Number of successful extensions: 333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 333 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -