BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0089 (816 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001310-1|AAH01310.1| 232|Homo sapiens chromosome 2 open readi... 30 8.7 AC012360-2|AAY15011.1| 232|Homo sapiens unknown protein. 30 8.7 >BC001310-1|AAH01310.1| 232|Homo sapiens chromosome 2 open reading frame 49 protein. Length = 232 Score = 30.3 bits (65), Expect = 8.7 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 122 NVGKTMAVPHEMLLHPELLSNEQLTHIIEQ 211 +VG E+LLHPELLS E L +EQ Sbjct: 4 DVGGRSCTDSELLLHPELLSQEFLLLTLEQ 33 >AC012360-2|AAY15011.1| 232|Homo sapiens unknown protein. Length = 232 Score = 30.3 bits (65), Expect = 8.7 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 122 NVGKTMAVPHEMLLHPELLSNEQLTHIIEQ 211 +VG E+LLHPELLS E L +EQ Sbjct: 4 DVGGRSCTDSELLLHPELLSQEFLLLTLEQ 33 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,665,051 Number of Sequences: 237096 Number of extensions: 1907643 Number of successful extensions: 7581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7581 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10147868276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -