BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0089 (816 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing ... 31 0.91 At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing ... 31 0.91 At2g34300.1 68415.m04196 dehydration-responsive protein-related ... 30 2.1 At1g76630.1 68414.m08916 tetratricopeptide repeat (TPR)-containi... 28 8.5 At1g10420.1 68414.m01174 hypothetical protein 28 8.5 >At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 420 Score = 31.1 bits (67), Expect = 0.91 Identities = 21/84 (25%), Positives = 38/84 (45%) Frame = +3 Query: 417 VERIKPPPDLLSGHMKRIKLENVTTKCSHMKVIIIKGKSSMILTLSLFXXXXXXXXXHGL 596 V+R+ P P++ + + +EN+ S+ + I GK+ I ++S+ G Sbjct: 178 VKRLSPLPEIRDPKIFTVLVENLPEDHSNENIREIFGKAGSIKSVSICDPNAVEESEKGG 237 Query: 597 KANQFRRNRQHIRYINEDVQNAQE 668 K F R R H E V+ A++ Sbjct: 238 KKENFIRTRLHAFVEYETVEAAEK 261 >At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 422 Score = 31.1 bits (67), Expect = 0.91 Identities = 21/84 (25%), Positives = 38/84 (45%) Frame = +3 Query: 417 VERIKPPPDLLSGHMKRIKLENVTTKCSHMKVIIIKGKSSMILTLSLFXXXXXXXXXHGL 596 V+R+ P P++ + + +EN+ S+ + I GK+ I ++S+ G Sbjct: 178 VKRLSPLPEIRDPKIFTVLVENLPEDHSNENIREIFGKAGSIKSVSICDPNAVEESEKGG 237 Query: 597 KANQFRRNRQHIRYINEDVQNAQE 668 K F R R H E V+ A++ Sbjct: 238 KKENFIRTRLHAFVEYETVEAAEK 261 >At2g34300.1 68415.m04196 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +2 Query: 425 NQTPS*FIIRSHETDKARKCNNKVLTHESNNHKRKIINDPNSEPIQAKKERK 580 ++ P F +E ++A NN+V T N+ + +N+ + E +A +ERK Sbjct: 70 DRDPKNFSDEKNEENEAATENNQVKTDSENSAEGNQVNESSGEKTEAGEERK 121 >At1g76630.1 68414.m08916 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile: PF00515 TPR Domain (5 copies) Length = 1064 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 45 IILCVGAIKLQI--ISVSMLHVIKSSSLTSEKQWLFL 149 ++LC I LQ+ I+ S+ H K+SSL+ +LFL Sbjct: 838 LLLCASEISLQMGNIAESINHARKASSLSLPSSYLFL 874 >At1g10420.1 68414.m01174 hypothetical protein Length = 133 Score = 27.9 bits (59), Expect = 8.5 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +3 Query: 324 SGRGKILNRTRHISPEPSRSLNKIKETRHTTVERIKP-PPDLLSGHMKRIKLENVTTK 494 +G+G I +R+ H S E S+NK K+T + +++ DL S + LE K Sbjct: 61 AGKGAISHRS-HYSCESGSSINKQKQTEEDCIRKVQELQADLASSRETQEALERKVWK 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,505,988 Number of Sequences: 28952 Number of extensions: 301835 Number of successful extensions: 670 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -