BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0087 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 23 3.0 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 3.0 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 3.0 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.3 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 9.2 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 22.6 bits (46), Expect = 3.0 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +2 Query: 419 LNLLLHCLISKNKTRKNNVDKAICYL*AKLGYAGFASKFIMF*INCNL 562 L LL L+ + DK +C+ + GY F IN NL Sbjct: 5 LCLLASALLISTHQTEAKTDKILCFFASWAGYRNGEGSFKPQNINANL 52 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -1 Query: 248 DTESKHEFNESIINYQVKKKKCLTLY 171 DTES ++FN+ N+ + + + Y Sbjct: 199 DTESSYQFNDPQFNFNYQYNQAYSNY 224 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -1 Query: 248 DTESKHEFNESIINYQVKKKKCLTLY 171 DTES ++FN+ N+ + + + Y Sbjct: 219 DTESSYQFNDPQFNFNYQYNQAYSNY 244 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 273 CIFYLLCKLMYISCM 317 CI+Y C L+ + C+ Sbjct: 284 CIYYFYCALIILLCI 298 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 103 IYRTRRYIYLFYA 65 I +T+RY Y +YA Sbjct: 107 IKKTKRYCYYYYA 119 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,908 Number of Sequences: 336 Number of extensions: 3099 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -