BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0087 (671 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003437-1|AAO39440.1| 1235|Drosophila melanogaster SD03652p pro... 30 3.3 AY274835-1|AAP31582.1| 1235|Drosophila melanogaster rigor mortis... 30 3.3 AE013599-3048|AAF57440.3| 1235|Drosophila melanogaster CG30149-P... 30 3.3 >BT003437-1|AAO39440.1| 1235|Drosophila melanogaster SD03652p protein. Length = 1235 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 671 NKIYTSGNDSHNTYMVHMRPSAQKWPILHFF 579 NK SGND + Y++ +P+ + W LH F Sbjct: 755 NKFAVSGNDK-SVYVMEFQPTERNWKTLHTF 784 >AY274835-1|AAP31582.1| 1235|Drosophila melanogaster rigor mortis protein. Length = 1235 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 671 NKIYTSGNDSHNTYMVHMRPSAQKWPILHFF 579 NK SGND + Y++ +P+ + W LH F Sbjct: 755 NKFAVSGND-RSVYVMEFQPTERNWKTLHTF 784 >AE013599-3048|AAF57440.3| 1235|Drosophila melanogaster CG30149-PB protein. Length = 1235 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 671 NKIYTSGNDSHNTYMVHMRPSAQKWPILHFF 579 NK SGND + Y++ +P+ + W LH F Sbjct: 755 NKFAVSGND-RSVYVMEFQPTERNWKTLHTF 784 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,652,420 Number of Sequences: 53049 Number of extensions: 463642 Number of successful extensions: 821 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2910007350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -