BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0087 (671 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 25 0.66 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 23 3.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 3.5 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 6.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.1 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 25.0 bits (52), Expect = 0.66 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 514 CRFCIKIYYVLNKLQFGRTTNMKKCRIGHFC 606 C++C K+Y L L+ T+ C+ H C Sbjct: 19 CKYCEKVYVSLGALKMHIRTHTLPCKC-HLC 48 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 671 NKIYTSGNDSHNTYMVHMRP 612 N +Y S SH+ Y V+M P Sbjct: 264 NNLYYSPLTSHSLYYVNMEP 283 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 354 HQRKSGLSLS*AYYSKHGDNDVSIYFYTAS*AKTKRAKIML 476 ++R S L + YYSKH + Y +S ++ KI L Sbjct: 374 NRRNSCLGSTETYYSKHNTQQFTQYIPESSSNLQEKTKIDL 414 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 499 SETRICRFCIKIYYVLNKLQ 558 S+ IC C ++Y LN L+ Sbjct: 30 SKEPICNICKRVYSSLNSLR 49 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 180 NAIFTSIIVILIVYDSEN 127 N +FTSI +L++ SEN Sbjct: 542 NGVFTSIASLLLLNLSEN 559 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,983 Number of Sequences: 438 Number of extensions: 3140 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -