BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0086 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0171 - 26441007-26441918 35 0.061 05_04_0337 - 20372378-20373094,20373320-20373379,20373992-203742... 33 0.19 06_01_0420 + 2998269-2999195 33 0.25 04_04_1125 + 31085106-31085714 32 0.57 11_03_0008 + 8901817-8902146,8903058-8903120,8903226-8903321,890... 31 0.75 07_03_1069 + 23743031-23744062 31 0.75 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.3 02_05_0617 + 30383334-30383579,30383592-30383681,30383772-303839... 31 1.3 01_03_0280 - 14546334-14546815,14546894-14547560,14550333-145517... 31 1.3 05_06_0169 + 26121830-26122135 30 1.7 03_06_0144 - 31969609-31969866,31969961-31970371,31970472-319705... 30 1.7 09_04_0115 - 14789499-14790288,14792055-14792441,14792820-14793193 30 2.3 06_03_0859 - 25473784-25473798,25473862-25473923,25474251-254743... 30 2.3 05_07_0123 + 27847555-27847953 30 2.3 03_06_0074 - 31476094-31476215,31477803-31478238,31478438-314784... 30 2.3 02_03_0064 + 14607975-14608925 30 2.3 11_01_0071 + 565349-565814,566626-566692,567255-567288,567747-56... 29 3.0 09_06_0022 - 20291787-20291864,20291989-20292010,20292269-202932... 29 3.0 08_02_0592 + 19064025-19066596,19067036-19067084,19068530-190686... 29 3.0 05_01_0323 - 2545281-2545784 29 3.0 01_06_1004 + 33721566-33721808 29 3.0 09_04_0531 + 18371435-18371504,18372729-18373222 29 4.0 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 29 4.0 11_06_0046 - 19585032-19585109,19585198-19585278,19585460-195855... 29 5.3 10_08_0763 + 20415944-20416178,20416293-20416615 29 5.3 06_03_0478 - 21259376-21259465,21259862-21259924,21260025-212600... 29 5.3 05_06_0050 - 25187164-25187526 29 5.3 03_05_0161 + 21400580-21401695 29 5.3 06_03_1516 + 30712208-30712780,30712984-30713139,30713819-307139... 28 7.0 04_04_1104 - 30928475-30928501,30929008-30929110,30929287-309293... 28 7.0 04_03_0778 + 19501208-19501328,19501447-19501637,19503150-195032... 28 7.0 03_02_0823 - 11538677-11539324 28 7.0 01_06_1842 - 40278875-40280131 28 7.0 01_06_1439 + 37374739-37375473 28 7.0 01_06_0604 + 30536172-30537143 28 7.0 11_06_0064 + 19733643-19734056 28 9.3 10_08_0802 + 20680685-20681059,20681218-20681353,20682047-206821... 28 9.3 07_01_0420 + 3212498-3213076 28 9.3 06_03_0930 - 26038341-26038508,26039114-26039254,26040799-260408... 28 9.3 06_03_0854 + 25400855-25403741,25406174-25407708 28 9.3 05_06_0149 - 25991761-25993181,25993246-25993324 28 9.3 03_06_0416 - 33780911-33781861 28 9.3 03_05_0524 - 25181432-25181483,25181565-25181691,25181776-251818... 28 9.3 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 28 9.3 02_05_0679 + 30817768-30818001 28 9.3 02_02_0096 - 6727844-6727957,6728149-6728247,6728332-6728410,672... 28 9.3 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 28 9.3 >02_05_0171 - 26441007-26441918 Length = 303 Score = 35.1 bits (77), Expect = 0.061 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -3 Query: 270 SESDTRRRRGGAGALC-----IPPPPTPRTACVERRTPAGSW-AAAPLRR 139 S S RR+RG A A +PPPP P A V+ PA W AA P+++ Sbjct: 251 SGSPKRRKRGEAAAASMAMALVPPPPPPAQAPVQLALPAQPWFAAGPIQQ 300 >05_04_0337 - 20372378-20373094,20373320-20373379,20373992-20374266, 20374358-20374619 Length = 437 Score = 33.5 bits (73), Expect = 0.19 Identities = 28/66 (42%), Positives = 29/66 (43%) Frame = -3 Query: 333 LLGLCSTAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAA 154 L G CS A A APP P L S T R + L PPPP P C T A AA Sbjct: 278 LQGECSAA-AAAPPPPPS--LPASATTRNSNASQLLMPPPPPRP--PCAAAYTSA---AA 329 Query: 153 APLRRA 136 AP A Sbjct: 330 APTESA 335 >06_01_0420 + 2998269-2999195 Length = 308 Score = 33.1 bits (72), Expect = 0.25 Identities = 22/63 (34%), Positives = 25/63 (39%) Frame = -3 Query: 366 ALEGRVLILAGLLGLCSTAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACV 187 A R L + G A AVA GP CV+S + T PPPP PR V Sbjct: 171 ATAARCLTFSSGGGKAVAAHAVAMEPGPSCVVSGTATGHYGVAVRVETPPPPPPPRPPPV 230 Query: 186 ERR 178 R Sbjct: 231 RER 233 >04_04_1125 + 31085106-31085714 Length = 202 Score = 31.9 bits (69), Expect = 0.57 Identities = 25/77 (32%), Positives = 31/77 (40%), Gaps = 1/77 (1%) Frame = -3 Query: 375 MVLALEGRVLILAGLLGLCST-APAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPR 199 M A GR+ +L L L + APA A G +C ++ C PPPPTP Sbjct: 1 MAAAKNGRIALLLAALALSAQLAPAAATWCGSNCPTTKPPPPP--------CQPPPPTPT 52 Query: 198 TACVERRTPAGSWAAAP 148 A TP W P Sbjct: 53 PA--TPTTPPTPWTPPP 67 >11_03_0008 + 8901817-8902146,8903058-8903120,8903226-8903321, 8903924-8903971,8904558-8904629,8905373-8905431, 8905582-8905672,8905749-8905886 Length = 298 Score = 31.5 bits (68), Expect = 0.75 Identities = 26/70 (37%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = -3 Query: 354 RVLILAGLLGLCSTAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVE--R 181 R+L L LL L + A + + +L + D GAGA P PP P A V R Sbjct: 8 RLLPLLLLLALSLSLAAASAFQSDELLLHDDDEFE---GAGARPTPGPPAPAAAAVSSSR 64 Query: 180 RTPAGSWAAA 151 R P S AAA Sbjct: 65 RRPGDSSAAA 74 >07_03_1069 + 23743031-23744062 Length = 343 Score = 31.5 bits (68), Expect = 0.75 Identities = 23/68 (33%), Positives = 29/68 (42%) Frame = -3 Query: 339 AGLLGLCSTAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSW 160 AG+ G A AVA C L R R+ G + + PP +P +R PA Sbjct: 34 AGVTGGGDGAAAVAATNRVLCQLQSRPCRARKRGRPS--VVPPVSPPAGAKRKRAPAYPV 91 Query: 159 AAAPLRRA 136 APLR A Sbjct: 92 PVAPLRCA 99 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 30.7 bits (66), Expect = 1.3 Identities = 32/103 (31%), Positives = 42/103 (40%), Gaps = 4/103 (3%) Frame = -3 Query: 444 SPSTASSRYSWAGFM*ASSMQGCM--VLALEGRVLILAGLLGLCSTAPAVAPPTGPDC-V 274 SP+ +SS S + A S C A R+ L+ L + P PP P Sbjct: 268 SPANSSSSSSSSS---APSTPSCSSDTAASRSRLPELSKLPPIPPPPPPPPPPPMPRSRS 324 Query: 273 LSESDTRRRRGGAGALCIPPPPTPRTACVER-RTPAGSWAAAP 148 S S + G AG PPPP P R TPA + ++AP Sbjct: 325 ASPSPSTSSSGSAGPPAPPPPPPPAAKRTSRTSTPATTSSSAP 367 >02_05_0617 + 30383334-30383579,30383592-30383681,30383772-30383901, 30384578-30384591 Length = 159 Score = 30.7 bits (66), Expect = 1.3 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = -3 Query: 312 APAVAPPTG---PDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPLR 142 APAV+PP+G P + + RG A +PPPP PR + PA P R Sbjct: 19 APAVSPPSGSYRPRRPAAPTAPPGSRGLAAQWLLPPPP-PRRSHRRLIAPAVPAEFPPSR 77 Query: 141 RAR 133 R+R Sbjct: 78 RSR 80 >01_03_0280 - 14546334-14546815,14546894-14547560,14550333-14551754, 14552831-14553127 Length = 955 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -3 Query: 255 RRRRGGAGALCIPPPPTPR---TACVERRTP 172 RRRR A A+ PPPP PR C + TP Sbjct: 25 RRRRRHAAAVATPPPPPPRRRANRCPDAATP 55 >05_06_0169 + 26121830-26122135 Length = 101 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 255 RRRRGGAGALCIPPPPTPR 199 RRRRGG + + PPP PR Sbjct: 60 RRRRGGGSGVAVLPPPRPR 78 >03_06_0144 - 31969609-31969866,31969961-31970371,31970472-31970542, 31970637-31970723,31970816-31971389 Length = 466 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 Query: 190 TSCSRSGRGRDTKCPCSAPPPP 255 TS S+ G GRDT P PPPP Sbjct: 50 TSGSKGGGGRDTSGPKPPPPPP 71 >09_04_0115 - 14789499-14790288,14792055-14792441,14792820-14793193 Length = 516 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = -3 Query: 312 APAVAPPTGPDCVLSESDTRRRRGGAGA--LCIPPP--PTPRTACVERRTPAGSWAAAP 148 +PA APPTGP + S + A A + + PP PT A + +PA + +P Sbjct: 54 SPAAAPPTGPASSPAASPALQTSAAAAASLVVVEPPASPTSAAATILGASPAPALPTSP 112 >06_03_0859 - 25473784-25473798,25473862-25473923,25474251-25474345, 25475718-25475831,25476490-25476695,25476834-25476959, 25479516-25480178 Length = 426 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 219 PPPPTPRTACVERRTPAGSWAAAPLRR 139 PPPP P+T +++PAGSW + RR Sbjct: 97 PPPPPPQT----QQSPAGSWRKSSRRR 119 >05_07_0123 + 27847555-27847953 Length = 132 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -3 Query: 237 AGALCIPPPPTPRTACVERRTPAGSWAAAPLRRARCCSQHI 115 A A PPPP PR E R + R+ CC H+ Sbjct: 20 ATAAAAPPPPPPRGEEEEVRRAVAECPVVVVGRSGCCLSHV 60 >03_06_0074 - 31476094-31476215,31477803-31478238,31478438-31478485, 31478569-31479018,31479567-31479681,31480052-31480905 Length = 674 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -3 Query: 315 TAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTP-AGSWAAAPLR 142 T P PP G + + +R R PPPP R A + +TP AGS ++ P R Sbjct: 59 TIPENGPPAG--MATATATPKRTRTPTSTCAPPPPPHARHAPMTGQTPVAGSRSSRPPR 115 >02_03_0064 + 14607975-14608925 Length = 316 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -3 Query: 306 AVAPPTG--PDCVLSESDTRRRRG-GAGALCIPPPP 208 A+ PP+G PD SES TRR RG AG+ P PP Sbjct: 78 ALVPPSGGGPDGAGSESATRRPRGRPAGSKNKPKPP 113 >11_01_0071 + 565349-565814,566626-566692,567255-567288,567747-567860 Length = 226 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +3 Query: 603 TATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQS-----TKHSPMSFTFII 752 T T TGR P P+DT T + + H PV + S T +P+S F++ Sbjct: 43 TPTNPTTGRPRPLPSDTTAAASTCSASPSHTPVSKPSSASGETTAPNPISARFVV 97 >09_06_0022 - 20291787-20291864,20291989-20292010,20292269-20293218, 20293339-20293629 Length = 446 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 261 DTRRRRGGAGALCIPPPPTP--RTACVERRTPAGSWAAAPLRRA 136 D RR+ A A PPPP+P TA + A + AAAP+ A Sbjct: 124 DIHRRKVVAAAAAAPPPPSPGMATAAAAVASGAVTVAAAPIPMA 167 >08_02_0592 + 19064025-19066596,19067036-19067084,19068530-19068605, 19068767-19068922 Length = 950 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = -3 Query: 267 ESDTRRRRGGAGALCIPPPPTPRTACVE--RRTPAGSW--AAAPLRRARCC 127 E T+R A PPPP P+ V R+ P G AAAP+ R R C Sbjct: 113 ELGTKRGLEERAARSPPPPPPPKRRAVSAIRQFPPGCGRDAAAPVARGRGC 163 >05_01_0323 - 2545281-2545784 Length = 167 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -3 Query: 270 SESDTRRRRGGAGALCIPPPPTPRTACVERRT 175 ++ D RRRRG +PPPP P A E RT Sbjct: 4 ADDDHRRRRGH-----VPPPPPPAAAEAEERT 30 >01_06_1004 + 33721566-33721808 Length = 80 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 279 CVLSESDTRRRRGGA----GALCIPPPPTPRTACVERRTPAGSWAA 154 CV S D RRGGA G P PRT+ R G+WAA Sbjct: 21 CVASHMDVDERRGGARAYMGGHGRPVGIRPRTSGSPRGLSGGTWAA 66 >09_04_0531 + 18371435-18371504,18372729-18373222 Length = 187 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 211 RGRDTKCPCSAPPPPC 258 RGRD + +APPPPC Sbjct: 46 RGRDEEVAAAAPPPPC 61 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 309 PAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTP 202 PAV PP C +S+ G GA C PPPP P Sbjct: 150 PAV-PPCAGGCSISDG------GACGASCKPPPPPP 178 >11_06_0046 - 19585032-19585109,19585198-19585278,19585460-19585501, 19586058-19586149,19586243-19586312,19587140-19587223, 19587696-19587770,19587878-19587949,19588082-19588331, 19590224-19590291,19590380-19590460,19590642-19590683, 19591240-19591331,19591425-19591494,19592322-19592405, 19592878-19592952,19593060-19593131,19593264-19593305 Length = 489 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 270 SESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAP 148 S RRRRG L PPPP P+ RR + A+ P Sbjct: 245 SSRHRRRRRGSPPLLPSPPPPPPQKLGSSRRECLMAAASIP 285 >10_08_0763 + 20415944-20416178,20416293-20416615 Length = 185 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -3 Query: 297 PPTGPDCVLSESDT--RRRRGGAGALCIPPPPTPRT 196 PP G V + +DT RRRRGGAG PP + +T Sbjct: 19 PPGGHRGVGAHNDTALRRRRGGAGRSSSRPPVSLQT 54 >06_03_0478 - 21259376-21259465,21259862-21259924,21260025-21260066, 21260180-21260461,21261084-21261587,21261973-21261981, 21262122-21262196,21262375-21262449,21262557-21263494, 21263577-21263607,21263694-21263979,21264691-21264905, 21265329-21265437,21265556-21265611,21265730-21265822, 21266348-21266393,21266496-21267221,21267489-21267550, 21267738-21268013,21268604-21268735,21268835-21268909 Length = 1394 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 582 RQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQS 716 R+ R+H A TP D R RA+ RP PRR + Sbjct: 377 RERDRKHPADSRREHTPPRTPGDRRRSSSVRAEKPLRRPSPRRDA 421 >05_06_0050 - 25187164-25187526 Length = 120 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -3 Query: 354 RVLILAGLLGLCSTAPAVAPPTGPDCVLSESDTRRRR---GGAGALCIPPPPTP 202 R + LA LL L S PP P+ + D R GG+ P PP P Sbjct: 18 RAVFLASLLVLASAQQQPRPPRAPEMSAVDVDAILARVCGGGSSRQAAPVPPLP 71 >03_05_0161 + 21400580-21401695 Length = 371 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/60 (31%), Positives = 24/60 (40%) Frame = -3 Query: 303 VAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPLRRARCCS 124 +AP G D V+ R+ G G PPPP P ++ P LR RC S Sbjct: 1 MAPAAGDDAVVP-----RKGAGGGGTTTPPPPPPAQQQQQQPLPPPPPQEQGLRCPRCDS 55 >06_03_1516 + 30712208-30712780,30712984-30713139,30713819-30713985, 30714108-30714357,30714400-30715182,30715437-30715753, 30715775-30716036 Length = 835 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 Query: 282 DCVLSESDTRRRRGGAGALCIPPPPTP 202 D L E +R G A A CI PPPTP Sbjct: 395 DLCLQEDPPKRNEGMAVA-CIEPPPTP 420 >04_04_1104 - 30928475-30928501,30929008-30929110,30929287-30929340, 30929803-30929895,30930063-30930140,30930416-30930527, 30930618-30930756,30930823-30930910,30930984-30931079, 30931675-30931781,30931874-30932009,30932089-30932186, 30932954-30933047,30933132-30933301,30933749-30933819, 30936066-30936194,30936552-30936654,30936764-30936907, 30937123-30937245,30937482-30937563,30939044-30939120, 30939261-30939315,30939365-30939443,30939544-30939620, 30939739-30939869,30939947-30940120,30940245-30940310, 30940937-30941572 Length = 1113 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 Query: 318 STAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPP 211 S++ A A P P T RR GG GA +PPP Sbjct: 57 SSSSAAATPAPPAPAAPPPPTSRRGGGGGA-ALPPP 91 >04_03_0778 + 19501208-19501328,19501447-19501637,19503150-19503237, 19503362-19503416,19505280-19505391 Length = 188 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 216 PPPTPRTACVERRTPAGSWAAAPL 145 PPP P TA V P + AAAP+ Sbjct: 64 PPPPPSTAPVPEEMPGAAAAAAPM 87 >03_02_0823 - 11538677-11539324 Length = 215 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 257 VSDSESTQSGPVGGATAGAVEHKPSKPAKIKTLPSNAST 373 +S S + GP GG AG +PSK A + ++A+T Sbjct: 83 LSPSARCRLGPAGGGRAGKRRPRPSKRAPTTYISTDAAT 121 >01_06_1842 - 40278875-40280131 Length = 418 Score = 28.3 bits (60), Expect = 7.0 Identities = 21/67 (31%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = -3 Query: 339 AGLLGLCSTAPAVAPPTGPDC---VLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPA 169 A +TAPA A GP V S +R G + PPP AC A Sbjct: 217 AAAAAAAATAPAAATAPGPAPARKVSSAPCSRSNSRGETSAAAPPPSIATAACAAAAAAA 276 Query: 168 GSWAAAP 148 + A AP Sbjct: 277 TAPAPAP 283 >01_06_1439 + 37374739-37375473 Length = 244 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -3 Query: 318 STAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRT 196 S +P AP T P V R + A PPPP RT Sbjct: 20 SPSPPPAPATAPPWVWPSCKNPRTQSFRAATAPPPPPGSRT 60 >01_06_0604 + 30536172-30537143 Length = 323 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 255 RRRRGGAGALCIPPPPTP 202 R+RRG GA PPPP P Sbjct: 31 RKRRGEEGAAAPPPPPPP 48 >11_06_0064 + 19733643-19734056 Length = 137 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPMSF 740 RR Q + LA T R P+PA R +T+ P P R S+ HS SF Sbjct: 81 RRPLQVYYLRRLAHTLRLAPSPAALAHRRVWRHNTAVSSPSPTRASS-HSAASF 133 >10_08_0802 + 20680685-20681059,20681218-20681353,20682047-20682180, 20682722-20682827,20683227-20683312,20683648-20683836, 20684349-20684522,20684638-20684751,20684887-20685141 Length = 522 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 292 HRPRLRALRVR-HTAAAGRSRGTLYPSPSHSENSLCRAKDAS 170 H PR + + H AAA S + P+P+ +E SL ++A+ Sbjct: 32 HHPRRPSFTLNAHQAAASSSAASAAPAPAFAEFSLAELREAT 73 >07_01_0420 + 3212498-3213076 Length = 192 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -3 Query: 432 ASSRYSWAGFM*ASSMQGCMVLALEGRVLILAGLLGLCSTAPAVAPPTGP 283 +S + SW+G A+++ C+ A+ LI+AG+ LC APP P Sbjct: 45 SSYKTSWSG---AAAVIVCLC-AVAAVFLIMAGITQLCKRVFPAAPPAPP 90 >06_03_0930 - 26038341-26038508,26039114-26039254,26040799-26040858, 26040972-26041034,26041444-26041454,26041722-26041802, 26042783-26043020,26043563-26043997 Length = 398 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 243 GGAGALCIPPPPTPR-TACVERRTPAGSWAAAPLRR 139 G GA C PPPP P TP + +P +R Sbjct: 111 GEDGAFCSPPPPPPPVVTAAAATTPTAAPTPSPAKR 146 >06_03_0854 + 25400855-25403741,25406174-25407708 Length = 1473 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Frame = -3 Query: 309 PAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPT--PRTACVERRTPA-GSWAAAPLRR 139 PA AP P+ +S + G + A PPT P V PA + AAAP+ + Sbjct: 1258 PASAPTMEPNATISPGSSTLAPGASAAAPAVAPPTAVPEAILVPMPPPAVAAAAAAPVPK 1317 Query: 138 AR 133 R Sbjct: 1318 KR 1319 >05_06_0149 - 25991761-25993181,25993246-25993324 Length = 499 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 237 AGALCIPPPPTPRTACVERRTPAG 166 A +C+P PTPR C+ AG Sbjct: 248 AAGVCVPDKPTPRVYCIGPLVDAG 271 >03_06_0416 - 33780911-33781861 Length = 316 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -3 Query: 306 AVAPP--TGPDCVLSESDTRRRRGGAGALCIPPPPTPR 199 AVAPP T P C + S RG A PPP TPR Sbjct: 29 AVAPPSPTTPQCAIPASPHTPGRGRA-----PPPATPR 61 >03_05_0524 - 25181432-25181483,25181565-25181691,25181776-25181826, 25182159-25182314,25182405-25182905,25182999-25183713, 25183797-25183867,25183974-25184103,25185706-25186167 Length = 754 Score = 27.9 bits (59), Expect = 9.3 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -3 Query: 315 TAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAP 148 +AP V PP P + + +PPPP P T PAG+ AAAP Sbjct: 372 SAPMVEPPPPPAMITPLPPS------TPVFTLPPPP-PVTTAPSTALPAGASAAAP 420 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 234 GALCIPPPPTPRTACVERRTPAGSWAAAP 148 G +C PPP P A R TP S A P Sbjct: 274 GVICRPPPSPPYFAPPPRATPTVSLAGPP 302 >02_05_0679 + 30817768-30818001 Length = 77 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 264 SDTRRRRGGAGALCIPPPPTPRTACVERRTP 172 +D GG+G + +PPPP+P R P Sbjct: 28 ADQASGAGGSGNIALPPPPSPHWTGGHRLPP 58 >02_02_0096 - 6727844-6727957,6728149-6728247,6728332-6728410, 6728534-6728634,6728740-6728808,6729180-6729220, 6729992-6730836,6730924-6731027,6731479-6732354 Length = 775 Score = 27.9 bits (59), Expect = 9.3 Identities = 22/73 (30%), Positives = 28/73 (38%) Frame = -3 Query: 354 RVLILAGLLGLCSTAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRT 175 R L L+G G A A P+G + RR A +PPPP A Sbjct: 6 RKLHLSGGGGSGGGAAAAGAPSGEH---HHRPRQHRRSSAQPPPLPPPPVVAAAAAAEAA 62 Query: 174 PAGSWAAAPLRRA 136 P + AAP+ A Sbjct: 63 PVMAPVAAPVAAA 75 >01_05_0292 + 20518668-20519090,20519213-20519281,20520204-20520473, 20520734-20521084,20521251-20521528,20522755-20523099, 20523346-20523911,20525155-20525528 Length = 891 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +2 Query: 584 TDTARTHRDTSRHRPTRADTGRHEATRADASRHEPTPAGSTTA 712 T R HRD R R R H+ R+ S H P PA + A Sbjct: 86 TPPRRDHRDRDRDRDRR-----HDDHRSAPSHHHPLPAAAAIA 123 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,492,251 Number of Sequences: 37544 Number of extensions: 415307 Number of successful extensions: 2919 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 2526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2866 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -