BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0086 (758 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB031038-1|BAA83417.1| 686|Homo sapiens hTbr2 protein. 33 1.5 M81750-1|AAA69696.1| 407|Homo sapiens myeloid cell nuclear diff... 32 2.0 BC032319-1|AAH32319.1| 407|Homo sapiens myeloid cell nuclear di... 32 2.0 BC020715-1|AAH20715.1| 310|Homo sapiens Unknown (protein for IM... 32 2.0 AL513205-11|CAH73796.1| 407|Homo sapiens myeloid cell nuclear d... 32 2.0 BC060820-1|AAH60820.1| 895|Homo sapiens zinc finger protein 281... 31 3.4 BC051905-1|AAH51905.1| 895|Homo sapiens zinc finger protein 281... 31 3.4 AJ132592-1|CAB70968.1| 895|Homo sapiens zinc finger protein pro... 31 3.4 AF125158-1|AAD21084.1| 895|Homo sapiens zinc finger DNA binding... 31 3.4 AK126249-1|BAC86503.1| 942|Homo sapiens protein ( Homo sapiens ... 31 4.5 BC070050-1|AAH70050.1| 1022|Homo sapiens SRRM2 protein protein. 31 6.0 AF201422-1|AAF21439.1| 2296|Homo sapiens splicing coactivator su... 31 6.0 AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein pro... 31 6.0 AB016088-1|BAA83714.1| 956|Homo sapiens RNA binding protein pro... 31 6.0 AB016087-1|BAA83713.1| 1262|Homo sapiens RNA binding protein pro... 31 6.0 AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein. 31 6.0 EF028204-1|ABL77400.1| 633|Homo sapiens CDK5 and Abl enzyme sub... 30 7.9 AK074369-1|BAB85062.1| 132|Homo sapiens protein ( Homo sapiens ... 30 7.9 >AB031038-1|BAA83417.1| 686|Homo sapiens hTbr2 protein. Length = 686 Score = 32.7 bits (71), Expect = 1.5 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -3 Query: 318 STAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPR--TACVERRTPAGSWAAAPL 145 S PA A P +LS++D A A+ P PP R + C E P+ + AAA Sbjct: 65 SGEPAAASAGAPAAMLSDTDAGDAFASAAAVAKPGPPDGRKGSPCGEEELPSAAAAAAAA 124 Query: 144 RRARCCSQHIS 112 A + S Sbjct: 125 AAAAAATARYS 135 >M81750-1|AAA69696.1| 407|Homo sapiens myeloid cell nuclear differentiation antigen protein. Length = 407 Score = 32.3 bits (70), Expect = 2.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 257 VSDSESTQSGPVGGATAGAVEHKPSKPAKIKTLPSNAS 370 VS +S GP G +T+ AV+H P P + PSN S Sbjct: 151 VSQEQSKPPGPSGASTSAAVDH-PPLPQTSSSTPSNTS 187 >BC032319-1|AAH32319.1| 407|Homo sapiens myeloid cell nuclear differentiation antigen protein. Length = 407 Score = 32.3 bits (70), Expect = 2.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 257 VSDSESTQSGPVGGATAGAVEHKPSKPAKIKTLPSNAS 370 VS +S GP G +T+ AV+H P P + PSN S Sbjct: 151 VSQEQSKPPGPSGASTSAAVDH-PPLPQTSSSTPSNTS 187 >BC020715-1|AAH20715.1| 310|Homo sapiens Unknown (protein for IMAGE:4717988) protein. Length = 310 Score = 32.3 bits (70), Expect = 2.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 257 VSDSESTQSGPVGGATAGAVEHKPSKPAKIKTLPSNAS 370 VS +S GP G +T+ AV+H P P + PSN S Sbjct: 151 VSQEQSKPPGPSGASTSAAVDH-PPLPQTSSSTPSNTS 187 >AL513205-11|CAH73796.1| 407|Homo sapiens myeloid cell nuclear differentiation antigen protein. Length = 407 Score = 32.3 bits (70), Expect = 2.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 257 VSDSESTQSGPVGGATAGAVEHKPSKPAKIKTLPSNAS 370 VS +S GP G +T+ AV+H P P + PSN S Sbjct: 151 VSQEQSKPPGPSGASTSAAVDH-PPLPQTSSSTPSNTS 187 >BC060820-1|AAH60820.1| 895|Homo sapiens zinc finger protein 281 protein. Length = 895 Score = 31.5 bits (68), Expect = 3.4 Identities = 24/58 (41%), Positives = 29/58 (50%) Frame = -3 Query: 312 APAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPLRR 139 A + APP P CVLS S + A A PPPP P ++ PA S AA P +R Sbjct: 67 AGSAAPP--PQCVLSSSTS-----AAPAAEPPPPPAPDMTF--KKEPAASAAAFPSQR 115 >BC051905-1|AAH51905.1| 895|Homo sapiens zinc finger protein 281 protein. Length = 895 Score = 31.5 bits (68), Expect = 3.4 Identities = 24/58 (41%), Positives = 29/58 (50%) Frame = -3 Query: 312 APAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPLRR 139 A + APP P CVLS S + A A PPPP P ++ PA S AA P +R Sbjct: 67 AGSAAPP--PQCVLSSSTS-----AAPAAEPPPPPAPDMTF--KKEPAASAAAFPSQR 115 >AJ132592-1|CAB70968.1| 895|Homo sapiens zinc finger protein protein. Length = 895 Score = 31.5 bits (68), Expect = 3.4 Identities = 24/58 (41%), Positives = 29/58 (50%) Frame = -3 Query: 312 APAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPLRR 139 A + APP P CVLS S + A A PPPP P ++ PA S AA P +R Sbjct: 67 AGSAAPP--PQCVLSSSTS-----AAPAAEPPPPPAPDMTF--KKEPAASAAAFPSQR 115 >AF125158-1|AAD21084.1| 895|Homo sapiens zinc finger DNA binding protein 99 protein. Length = 895 Score = 31.5 bits (68), Expect = 3.4 Identities = 24/58 (41%), Positives = 29/58 (50%) Frame = -3 Query: 312 APAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPLRR 139 A + APP P CVLS S + A A PPPP P ++ PA S AA P +R Sbjct: 67 AGSAAPP--PQCVLSSSTS-----AAPAAEPPPPPAPDMTF--KKEPAASAAAFPSQR 115 >AK126249-1|BAC86503.1| 942|Homo sapiens protein ( Homo sapiens cDNA FLJ44261 fis, clone TLIVE2001327, moderately similar to Human DOCK180 protein mRNA. ). Length = 942 Score = 31.1 bits (67), Expect = 4.5 Identities = 16/57 (28%), Positives = 24/57 (42%) Frame = -3 Query: 315 TAPAVAPPTGPDCVLSESDTRRRRGGAGALCIPPPPTPRTACVERRTPAGSWAAAPL 145 + P PP P + S + G A +PPPP P++ E + + A PL Sbjct: 857 STPLSPPPLTPKATRTLSSPSLQTDGIAATPVPPPPPPKSKPYEGSQRSSTELAPPL 913 >BC070050-1|AAH70050.1| 1022|Homo sapiens SRRM2 protein protein. Length = 1022 Score = 30.7 bits (66), Expect = 6.0 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPM 734 RR R T + R PT +R P R SR R RR+S SP+ Sbjct: 580 RRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPV 631 >AF201422-1|AAF21439.1| 2296|Homo sapiens splicing coactivator subunit SRm300 protein. Length = 2296 Score = 30.7 bits (66), Expect = 6.0 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPM 734 RR R T + R PT +R P R SR R RR+S SP+ Sbjct: 580 RRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPV 631 >AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein protein. Length = 2752 Score = 30.7 bits (66), Expect = 6.0 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPM 734 RR R T + R PT +R P R SR R RR+S SP+ Sbjct: 580 RRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPV 631 >AB016088-1|BAA83714.1| 956|Homo sapiens RNA binding protein protein. Length = 956 Score = 30.7 bits (66), Expect = 6.0 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPM 734 RR R T + R PT +R P R SR R RR+S SP+ Sbjct: 545 RRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPV 596 >AB016087-1|BAA83713.1| 1262|Homo sapiens RNA binding protein protein. Length = 1262 Score = 30.7 bits (66), Expect = 6.0 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPM 734 RR R T + R PT +R P R SR R RR+S SP+ Sbjct: 370 RRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPV 421 >AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein. Length = 2800 Score = 30.7 bits (66), Expect = 6.0 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = +3 Query: 579 RRQTQREHTATLADTGRREPTPADTRLHEPTRADTSRHRPVPRRQSTKHSPM 734 RR R T + R PT +R P R SR R RR+S SP+ Sbjct: 628 RRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPV 679 >EF028204-1|ABL77400.1| 633|Homo sapiens CDK5 and Abl enzyme substrate 1 protein. Length = 633 Score = 30.3 bits (65), Expect = 7.9 Identities = 30/91 (32%), Positives = 36/91 (39%), Gaps = 10/91 (10%) Frame = -3 Query: 396 ASSMQGCMVLALEGRVLI-LAGLLGLCSTAPAVAPPTGPDCVLSESDTRRRRG-----GA 235 A+ GC+ LA G LA G C P+ PP P + S RG GA Sbjct: 113 AAERGGCIALAAPGTPAAGLAAGSGPCLPQPSSLPPLIPGGHATVSGPGVARGFASPLGA 172 Query: 234 GALC----IPPPPTPRTACVERRTPAGSWAA 154 G PP P P AC + + GS AA Sbjct: 173 GRASGEQWQPPRPAPLAACAQLQLLDGSGAA 203 >AK074369-1|BAB85062.1| 132|Homo sapiens protein ( Homo sapiens cDNA FLJ23789 fis, clone HEP21465. ). Length = 132 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 717 CSAVVEPAGVGSCRLASARVASCRPVSARVGRCRLVSRCVL 595 C V E G+CRL+ + + S RV CR ++RC++ Sbjct: 71 CCLVHEQTYRGACRLSPRALVLLKEFSGRVRPCRELARCLV 111 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,805,746 Number of Sequences: 237096 Number of extensions: 1901757 Number of successful extensions: 9135 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 7752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9069 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9183116696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -