BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0084 (833 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 26 0.49 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 2.6 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.8 bits (54), Expect = 0.49 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 154 FVRVVGVDRAVSPRARVFLNPLKRIEERFA 65 F ++ VDR+ SP R +NP++ ++ FA Sbjct: 6 FSKISKVDRSTSPLPRKPVNPVQELKALFA 35 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 420 HDLHDEVLSRRQRLVTVRLAPL 355 H +H E LSR QR + RL L Sbjct: 107 HAVHKEQLSREQRFLRRRLEQL 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,209 Number of Sequences: 438 Number of extensions: 4202 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -