BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0082 (784 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccha... 26 5.3 SPAC30C2.05 |erv14||cornichon family protein Erv14|Schizosacchar... 26 5.3 >SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccharomyces pombe|chr 1|||Manual Length = 549 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 577 RSRPRYESYFNSSSQKTF 524 R RP Y S F+ SSQ TF Sbjct: 492 RKRPGYSSSFDGSSQSTF 509 >SPAC30C2.05 |erv14||cornichon family protein Erv14|Schizosaccharomyces pombe|chr 1|||Manual Length = 141 Score = 26.2 bits (55), Expect = 5.3 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = -2 Query: 510 LNKDWVLNEFNLIY*IKHCDDM*IQTFVVFPNNNYICIFLAHKYRLYI--CLYCVIVFYI 337 L K W+L NL + H + + +T ++ + + HK +I Y ++ F + Sbjct: 71 LGKKWLLFLANLPLLVFHANQVIHKTHILDATEIFRQLG-RHKRDNFIKVTFYLIMFFTL 129 Query: 336 YYCTIVSLVQ 307 YC ++SL+Q Sbjct: 130 LYCMVMSLIQ 139 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,464,327 Number of Sequences: 5004 Number of extensions: 40455 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -