BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0082 (784 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0127 + 1031690-1031952,1032850-1032857,1034679-1034927,103... 29 4.2 05_03_0085 - 8271718-8272005,8272110-8272393,8273610-8274012,827... 28 9.6 >11_01_0127 + 1031690-1031952,1032850-1032857,1034679-1034927, 1034938-1035009,1036609-1036724,1037482-1037545, 1037742-1037773,1037804-1037850,1038627-1038660, 1039308-1039652,1040425-1040718,1040968-1041232, 1041359-1041480,1041754-1042059 Length = 738 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 570 GRATKATLIPHRRKRSG 520 GRAT+A +PHRR+R G Sbjct: 45 GRATRAEALPHRRRRLG 61 >05_03_0085 - 8271718-8272005,8272110-8272393,8273610-8274012, 8274792-8274816,8275686-8276149 Length = 487 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -2 Query: 429 VVFPNNNYICIFLAHKYRLYICLYCVIVFYIYYCTIVSLVQPLSTYDRTT*NYRT 265 V+ P +L HK L+ L+ ++ F Y +V ++ Y+RT N+ T Sbjct: 323 VLVPLGAIAARYLRHKDPLWYYLHVLVQFLGYIIGFAGVVSGIALYNRTYSNFTT 377 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,610,281 Number of Sequences: 37544 Number of extensions: 216084 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -