BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0082 (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.4 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.8 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 9.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -1 Query: 283 YLELQNN*YFNSCSKNRTLKRTEYLILRCTSR 188 ++ +Q +F KN+T +R E +L+C ++ Sbjct: 770 FISVQAPPHFEIKLKNQTARRGEPAVLQCEAQ 801 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 259 YFNSCSKNRTLKRTEYLILRCTSRSCLT 176 +FN + +TL T LI+ C S S L+ Sbjct: 226 FFNITLRRKTLFYTVNLIVPCVSISYLS 253 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 366 CLYCVIVFYIYYCTIVSLVQPL 301 C+ C FY Y T+ S PL Sbjct: 194 CVVCQNFFYQIYATLGSFYIPL 215 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,474 Number of Sequences: 438 Number of extensions: 2993 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -