BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0081 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 27 0.57 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 25 1.7 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 27.1 bits (57), Expect = 0.57 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 449 YTATWSINASSTACS*ISCKPITEDEKNFKAYQYLRGARSI 571 + +++ IN +ST + + K +TE EK F +YL AR I Sbjct: 44 HQSSFMINNNSTGRTNFTNKQLTELEKEFHFNKYLTRARRI 84 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 417 GEANEEERKLATQLRGPLMPVQQPAPKSVASLSLKMKRTSK 539 G A E++ + GPL+P + VA L+ +RT K Sbjct: 79 GNAGMVEKRTSMVDEGPLVPYPWAIDREVAYAFLRTRRTGK 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,651 Number of Sequences: 2352 Number of extensions: 13374 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -