BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0081 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.52 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.69 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.69 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 4.9 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.5 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.52 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 125 FCFLRYRRAGWLNQVLTNLCQSLWKC 48 FC+ R A W N V NL SL KC Sbjct: 538 FCYFRRNAATWKNAVRHNL--SLHKC 561 Score = 21.4 bits (43), Expect = 8.5 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 462 GPLMPVQQPAPKSVASLSLKMKRTSKLINT*EELAPLPNSS 584 GP PKSVA L++ +R+ T + PL SS Sbjct: 230 GPESHQNSNVPKSVAGLNVSSRRSDMNGTTPLDEKPLDVSS 270 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 296 SNRSGKYWVQSCGPISRRVNPLPARTLVWYRTVGHRTI 183 +N V CG S +N PAR + R+V +TI Sbjct: 294 ANEVATILVDDCGCNSTMLNENPARVMACMRSVDAKTI 331 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 296 SNRSGKYWVQSCGPISRRVNPLPARTLVWYRTVGHRTI 183 +N V CG S +N PAR + R+V +TI Sbjct: 294 ANEVATILVDDCGCNSTMLNENPARVMACMRSVDAKTI 331 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 150 SSTSCSWAVTSY 185 S + C+W +TSY Sbjct: 66 SGSKCTWTITSY 77 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 233 EDSLFVK*GRRIEPSICPNDWNCCRS 310 ED++ V + E + P NCCRS Sbjct: 378 EDTMSVDRMQHCELHMQPRKKNCCRS 403 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 233 EDSLFVK*GRRIEPSICPNDWNCCRS 310 ED++ V + E + P NCCRS Sbjct: 378 EDTMSVDRMQHCELHMQPRKKNCCRS 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,845 Number of Sequences: 438 Number of extensions: 3786 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -