BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0079 (761 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Ma... 27 2.9 SPBP16F5.02 |mcs2||cyclin Mcs2|Schizosaccharomyces pombe|chr 2||... 27 3.9 SPBC342.05 |crb2|rhp9, rhp9|DNA repair protein RAD9 homolog, Rhp... 26 5.1 SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharo... 26 5.1 SPAC5D6.12 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 6.7 SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosac... 25 8.9 SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotr... 25 8.9 >SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 27.1 bits (57), Expect = 2.9 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 395 INFAHSNIFKLTKCNYHYINHVALLYYTISKMCH--NSYS 508 +NFAH N+ L N ++N + L T+S +C +SYS Sbjct: 138 LNFAHENLAPLAPSNQKFLNSLEL---TMSLLCFPPSSYS 174 >SPBP16F5.02 |mcs2||cyclin Mcs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 322 Score = 26.6 bits (56), Expect = 3.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 344 FRSLYCQNDNEE*SFSKINFAHSNIFKLTKCNYHYIN 454 F+ Y N E S I+F +++F TKCN HYI+ Sbjct: 98 FKRFYLINSVMEYSPKIISF--TSLFLATKCNDHYIS 132 >SPBC342.05 |crb2|rhp9, rhp9|DNA repair protein RAD9 homolog, Rhp9|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 26.2 bits (55), Expect = 5.1 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -1 Query: 755 NKSLNNARELEDLILAQLIKIPSFNETKIYSQENSTDSDI 636 +K +NN +E+L L QL ++PS S ++ +D ++ Sbjct: 58 SKDVNNNGAVEELSLTQLFEVPSQAAFAKQSSQDISDDEL 97 >SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 26.2 bits (55), Expect = 5.1 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -1 Query: 143 FHTLYYFCTVKFIIISTIHN*FCILY 66 F L++ C++ F+I +H+ C++Y Sbjct: 221 FFVLHHMCSIGFLITIWLHHRRCVVY 246 >SPAC5D6.12 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 314 Score = 25.8 bits (54), Expect = 6.7 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 544 HHHRSFILV*KHHNLMFKTFNAYFKLYKSQVISESVLFSCEYILV-SLKDGIFI 702 H H S + V ++H L +T +A +L+KS++ + F ++ L +L+D + I Sbjct: 156 HTHSSPLTVYRNHLLTCETDSALAQLFKSEIYQQLSDFRRDFPLSHALRDTMLI 209 >SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosaccharomyces pombe|chr 2|||Manual Length = 1172 Score = 25.4 bits (53), Expect = 8.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +1 Query: 664 EYILVSLKDGIFINCARI 717 ++I+VSLK+G+F N R+ Sbjct: 1140 QFIIVSLKEGMFTNANRL 1157 >SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotransferase subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 437 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 213 ITQFYITRFQSLV*HGYPPYNAGFSHVILF-LYCEIY 106 + QF+ F + H YP Y + FS + F L+C I+ Sbjct: 384 LRQFFHNEFPRFLPHAYPYYASCFSVLGAFLLFCGIW 420 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,040,018 Number of Sequences: 5004 Number of extensions: 63816 Number of successful extensions: 132 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -