BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0079 (761 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003314-1|AAO25074.1| 1430|Drosophila melanogaster GH02877p pro... 29 5.2 AE014134-1128|AAF52413.2| 1257|Drosophila melanogaster CG11098-P... 29 5.2 AE014134-1127|AAF52414.2| 1430|Drosophila melanogaster CG11098-P... 29 5.2 >BT003314-1|AAO25074.1| 1430|Drosophila melanogaster GH02877p protein. Length = 1430 Score = 29.5 bits (63), Expect = 5.2 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -1 Query: 758 ENKSLNNARELEDLILAQLIKIPSFNETKIYSQENSTDSDIT 633 +NKS+N + EL+ L +AQL K ++K ++E + +++ Sbjct: 312 DNKSINESIELKPLSVAQLKKTDKVEDSKDETKEKHAEMEVS 353 >AE014134-1128|AAF52413.2| 1257|Drosophila melanogaster CG11098-PB, isoform B protein. Length = 1257 Score = 29.5 bits (63), Expect = 5.2 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -1 Query: 758 ENKSLNNARELEDLILAQLIKIPSFNETKIYSQENSTDSDIT 633 +NKS+N + EL+ L +AQL K ++K ++E + +++ Sbjct: 312 DNKSINESIELKPLSVAQLKKTDKVEDSKDETKEKHAEMEVS 353 >AE014134-1127|AAF52414.2| 1430|Drosophila melanogaster CG11098-PA, isoform A protein. Length = 1430 Score = 29.5 bits (63), Expect = 5.2 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -1 Query: 758 ENKSLNNARELEDLILAQLIKIPSFNETKIYSQENSTDSDIT 633 +NKS+N + EL+ L +AQL K ++K ++E + +++ Sbjct: 312 DNKSINESIELKPLSVAQLKKTDKVEDSKDETKEKHAEMEVS 353 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,610,022 Number of Sequences: 53049 Number of extensions: 608547 Number of successful extensions: 789 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3499501170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -