BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0076 (776 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9NKU6 Cluster: Putative uncharacterized protein; n=3; ... 36 1.5 UniRef50_A0Q659 Cluster: Kinase-like protein; n=17; Francisella ... 34 4.6 UniRef50_Q17DR7 Cluster: Putative uncharacterized protein; n=1; ... 33 8.0 >UniRef50_Q9NKU6 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 1022 Score = 35.5 bits (78), Expect = 1.5 Identities = 14/48 (29%), Positives = 29/48 (60%) Frame = +1 Query: 19 VVQTRRHLGLRLTSLLQSVSLFFILVFYIDIFSNTFDLVIYNRKNFYL 162 V+ TR HLGL L + + ++++ ++++ FS++F + K FY+ Sbjct: 725 VLDTRDHLGLFLIGSYMTFASYYMIYYFLERFSDSFRRIASQDKKFYI 772 >UniRef50_A0Q659 Cluster: Kinase-like protein; n=17; Francisella tularensis|Rep: Kinase-like protein - Francisella tularensis subsp. novicida (strain U112) Length = 167 Score = 33.9 bits (74), Expect = 4.6 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -1 Query: 557 YLARAWPHVRCVKGYMIVYYQRWQSVHLDKKMLLIC 450 YL +A+P +GY +VYYQ +++ L K +++ C Sbjct: 40 YLKKAYPQEPTKQGYELVYYQAKENLELGKNVIIDC 75 >UniRef50_Q17DR7 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 890 Score = 33.1 bits (72), Expect = 8.0 Identities = 12/52 (23%), Positives = 25/52 (48%) Frame = -1 Query: 338 EFCGCQWNTKSIIRFSDLPIIVQKSHCRFDNSLLICMFQFRMGISCFIKEKC 183 + C C + + F D ++++S+CR D +L C + ++K+ C Sbjct: 470 KLCNCDEHWLKELYFQDYDKLLKESYCRIDETLKYCFNASTFNVKVYMKQVC 521 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 774,269,905 Number of Sequences: 1657284 Number of extensions: 16027381 Number of successful extensions: 31296 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31288 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65438977305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -