BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0076 (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17129| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-07) 30 1.8 SB_20108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) 29 4.2 SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_17129| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-07) Length = 350 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 617 DYFVPLIFGNSSANFKIY 670 DYFVPL++ NS NF +Y Sbjct: 235 DYFVPLLYANSFINFVLY 252 >SB_20108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.1 bits (62), Expect = 4.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 368 PVIYLRCRSEEFCGCQWNTKS 306 PV+Y+RC ++C W+ KS Sbjct: 359 PVLYIRCEDPKYCPVLWHYKS 379 >SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) Length = 1306 Score = 29.1 bits (62), Expect = 4.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 368 PVIYLRCRSEEFCGCQWNTKS 306 PV+Y+RC ++C W+ KS Sbjct: 1128 PVLYIRCEDPKYCPVLWHYKS 1148 >SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 492 VAICAFGQKNVIDMSIQIDLNIIVSFKEYGSKPAL 388 V I +FG K +S + N+++SF + G KP L Sbjct: 157 VGIVSFGDKTKQILSRTLGKNMLMSFMDVGKKPPL 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,237,137 Number of Sequences: 59808 Number of extensions: 513485 Number of successful extensions: 872 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -