BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0076 (776 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 24 6.0 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 24 6.0 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 24 6.0 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 24 6.0 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 24 6.0 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 24 6.0 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 24 6.0 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 24 6.0 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 24 6.0 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 765 SSKKTTKVPGKCTHNELRLK 706 S+ TT +C HNELR K Sbjct: 215 STMHTTAFVRRCLHNELRCK 234 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 144 PKKLLLIPHETRCALFFYKAAYSHSELKHT 233 P ++ IPHET C ++ Y EL+ T Sbjct: 101 PDHMVYIPHETDCGKYYICDPYG-VELEQT 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 826,284 Number of Sequences: 2352 Number of extensions: 16365 Number of successful extensions: 29 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -