BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0074 (815 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Ma... 29 0.79 SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|... 28 1.8 >SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 29.1 bits (62), Expect = 0.79 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 527 HPYLTLRNPVTPLHGVHSIRHVLLLRVNESEIQPSLTS 414 +PY R P+ P H V S R L+VN + PS S Sbjct: 222 YPYELQRKPLIPAHPVPSFRPTSALKVNMNSNVPSSDS 259 >SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 27.9 bits (59), Expect = 1.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 468 ADAVYPVEWGYRISEGEIRVVSFESEMDRIL 560 AD V+W Y ++EGEI + S I+ Sbjct: 579 ADLTMDVQWSYNLAEGEIVIASIRRNPHEIV 609 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,208,226 Number of Sequences: 5004 Number of extensions: 64041 Number of successful extensions: 159 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -