BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0074 (815 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0172 + 26138238-26138474,26138712-26139854 31 1.1 01_01_0014 + 84379-84600,84737-84830,84935-85086,85212-85299,853... 29 4.4 >05_06_0172 + 26138238-26138474,26138712-26139854 Length = 459 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 449 VNESEIQPSLTSDCDGR*GCNGIRHEQSVECITK 348 ++ESE Q S D GCNG H + V+ IT+ Sbjct: 412 LDESERQESPKDDVKAELGCNGFHHREKVDQITE 445 >01_01_0014 + 84379-84600,84737-84830,84935-85086,85212-85299, 85348-86681,87291-87398,87500-87583 Length = 693 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = -1 Query: 587 YNRSLPFLS*NAIHFTLEAHHPYLTLRNPVTPLHGVHSIRHVLLLRVNESEIQPSL 420 Y R LPF++ N H +HH L+ + +T G H + L++ +S +L Sbjct: 175 YKRMLPFVTENGYHIANLSHHVLLSTFSEITSQEG-HRTKIPRLVQEKQSSTDENL 229 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,339,688 Number of Sequences: 37544 Number of extensions: 374240 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -