BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0074 (815 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 26 0.36 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 26 0.36 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 4.5 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 26.2 bits (55), Expect = 0.36 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 358 HSTDC-SCLIPLHPYLPSQSLVKLGCISDSFTLSSKTWRM 474 H + C L+P+ PS S V + + DSF L +W + Sbjct: 291 HWSGCLQFLVPMLQGFPSNSWVAINELQDSFWLEQYSWAL 330 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 26.2 bits (55), Expect = 0.36 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 358 HSTDC-SCLIPLHPYLPSQSLVKLGCISDSFTLSSKTWRM 474 H + C L+P+ PS S V + + DSF L +W + Sbjct: 259 HWSGCLQFLVPMLQGFPSNSWVAINELQDSFWLEQYSWAL 298 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 665 YLQKNCNKKLINIMMTTLISLFYVMMFNLC 754 YL N L NIM F +M+ N C Sbjct: 338 YLSTTVNPLLYNIMSNKFREAFKLMLPNCC 367 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,989 Number of Sequences: 438 Number of extensions: 4337 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -