BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0071 (799 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 27 0.17 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.7 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.9 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 27.1 bits (57), Expect = 0.17 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -1 Query: 613 VWPLALISGCFLNNNQPMWEKKNPRVALWGSASVSNICGACDDHGPNPLRH 461 V+P +IS C+ + +W K + + G + CDDH P RH Sbjct: 216 VFPALIISACYAVIVRTIWSKSKLLIPV-GHIPIRQ----CDDHRDRPPRH 261 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 709 HMYQHCGEKQFGTPSTSANF 768 H+ H GEK+F P + F Sbjct: 365 HLRTHTGEKRFACPICNKRF 384 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 591 EIKAKGHTVDVNDLRNDP 644 E+K GH + +N ++ DP Sbjct: 500 EVKFLGHILTINGIKADP 517 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,626 Number of Sequences: 336 Number of extensions: 5461 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -