BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0071 (799 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 26 1.6 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 25 2.7 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 25 2.7 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 25 3.6 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 25 3.6 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 25 3.6 AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 prot... 24 4.7 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 24 6.3 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 24 6.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.3 AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A prot... 23 8.3 AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A prot... 23 8.3 AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A prot... 23 8.3 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 8.3 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 23 8.3 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 355 IGYHSWRAQTLGTQVLKARLPLRILLT 435 IGY + Q+ G Q+ +A P +LLT Sbjct: 427 IGYAGVQIQSFGVQLNRANAPANVLLT 453 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPASKPSPN 94 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPASKPSPN 94 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 3.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPAPKPSPN 94 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 24.6 bits (51), Expect = 3.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D AQ+ CAP V PN E K N Sbjct: 70 DYPAQAQCAPGVTPNTEPAPKPSPN 94 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 412 LPLRILLTIFNTIAFQDAVVDWARDHRMHHKY 507 LP ILL N + F ++V W + + ++ Y Sbjct: 79 LPHAILLAKLNKVRFPCSLVQWLKSYLINRTY 110 >AF030431-1|AAC39127.1| 153|Anopheles gambiae peritrophin 1 protein. Length = 153 Score = 24.2 bits (50), Expect = 4.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPE 349 D AQ+ CAP V PN E Sbjct: 70 DYPAQAQCAPGVTPNTE 86 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 179 RCTAPCTSLSREETLEDCVEKC 244 +C PC L+ T+ DC +C Sbjct: 62 KCCGPCYQLNCYGTVLDCAGRC 83 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 258 FCMSVVFMEGTCSFSKPC 311 F +V+F GT SF+ PC Sbjct: 552 FFQNVIFYFGTASFAIPC 569 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +1 Query: 412 LPLRILLTIFNTIAFQDAVVDWARDHRMHHKY 507 LP ILL + + +V W + + +H Y Sbjct: 694 LPHAILLAKLDKLGIPSPLVQWLKSYLIHRTY 725 >AY344828-1|AAR02439.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D +Q+ CAP V PN E K N Sbjct: 70 DYPSQAQCAPGVTPNTEPAPKPSPN 94 >AY344827-1|AAR02438.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D +Q+ CAP V PN E K N Sbjct: 70 DYPSQAQCAPGVTPNTEPAPKPSPN 94 >AY344826-1|AAR02437.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 399 DLCAQSLCAPAVIPNPEHKYKNMAN 325 D +Q+ CAP V PN E K N Sbjct: 70 DYPSQAQCAPGVTPNTEPAPKPSPN 94 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 562 LAGCC*GSIPKSKP 603 L GCC G+ PK +P Sbjct: 1066 LVGCCIGAKPKQQP 1079 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 570 LLLRKHPEIKAKGHTVDVNDLRNDP 644 LLL +HPE++ + + V + NDP Sbjct: 22 LLLARHPEVQERVYREVVAIVGNDP 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 957,672 Number of Sequences: 2352 Number of extensions: 22524 Number of successful extensions: 55 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -