BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0070 (803 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0173 - 23294511-23294601,23294719-23294849,23295160-232954... 30 1.9 04_04_0384 - 24853689-24853727,24853802-24853861,24854311-248543... 29 5.7 12_01_0210 - 1593732-1593823,1594730-1594773,1594895-1594983,159... 28 10.0 10_06_0018 - 9674771-9674995,9675079-9675126,9675471-9675530,967... 28 10.0 >04_04_0173 - 23294511-23294601,23294719-23294849,23295160-23295483, 23296016-23296147,23296225-23296373,23296536-23296670, 23296997-23297090,23297199-23297318,23298096-23298182, 23298273-23298386,23299089-23299270,23299960-23300023, 23300191-23300337,23300636-23300845,23301048-23301217, 23301355-23301477,23301589-23301661,23301765-23301857 Length = 812 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 524 LHNRTTKQLKSADPLIIFSNDNISNGPKDSKSF 622 L N+ T + K PLI F D +SN P DSK + Sbjct: 358 LRNKDTME-KHLSPLITFIPDLVSNAPDDSKGY 389 >04_04_0384 - 24853689-24853727,24853802-24853861,24854311-24854357, 24854487-24854565,24855184-24855279,24855645-24855714, 24855787-24855857,24856010-24856105,24856501-24856628, 24856733-24856853 Length = 268 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/61 (22%), Positives = 29/61 (47%) Frame = -3 Query: 267 YSIRQENFRTCSF*NFCIILYHPQMLAVILPMKMITLRICRYPSHNFLPRIIYLQYINNI 88 YS+++EN + + + H + ++ M+ + IC P H FL I +Y + + Sbjct: 107 YSVKKENITIMTT---IVTVMHAYKIVLLPLFPMLRVNICFMPIHLFLSYFIVQKYCSEV 163 Query: 87 I 85 + Sbjct: 164 V 164 >12_01_0210 - 1593732-1593823,1594730-1594773,1594895-1594983, 1595076-1595120,1595457-1595564,1595647-1595732, 1595872-1595959,1596159-1596335,1596531-1596606, 1596709-1596758,1596834-1596896,1597152-1597254, 1597337-1597439,1597559-1597619,1598119-1598159, 1599790-1599961 Length = 465 Score = 27.9 bits (59), Expect = 10.0 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 6/97 (6%) Frame = -2 Query: 655 IRYYLCCGFVSK*F*IFRTVTNIVITKDYQRVGRFQL--FSCSVM*IWMLIVFLVSKFWL 482 I YY GF+ + + R+ I R+GR + FS + I+ + L +K+W+ Sbjct: 84 IGYY--AGFLGASYMVGRSFAAIFWGVVADRIGRKPVIVFSILSVVIFNTLFGLSTKYWM 141 Query: 481 S----FKLTSLPSNGILSPFSINVTFVSIFAAGPSNG 383 + F L +L NG+L+P +N + GP+ G Sbjct: 142 ALTTRFVLGAL--NGLLAPIKVNTAWGLGLVVGPALG 176 >10_06_0018 - 9674771-9674995,9675079-9675126,9675471-9675530, 9675693-9675758,9675844-9675906,9675985-9676032, 9676150-9676215,9676493-9676558,9676660-9676725, 9676822-9676887,9676975-9677058,9677310-9677654, 9677738-9677833,9678129-9678332,9678434-9678726, 9678833-9678958,9679217-9679226 Length = 643 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 411 DTNVTFMLN-GESMPLDGSDVNLKDNQNLDTKNTINIQI 524 DT+ F +N GES DV++ D N DT IN+++ Sbjct: 8 DTDDDFDINDGESNEDTNDDVDIDDESNEDTDVDINVRV 46 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,096,179 Number of Sequences: 37544 Number of extensions: 364548 Number of successful extensions: 761 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -