BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0070 (803 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_37711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/57 (24%), Positives = 31/57 (54%) Frame = +2 Query: 542 KQLKSADPLIIFSNDNISNGPKDSKSFGHKTTAQVISYERNSAYRSTLRTEELPNIS 712 K L + + ++SND G + + + + V+ YE+NS Y ++L + ++P ++ Sbjct: 478 KTLDEMEAMSLYSNDGDFTGTEITANGPVSVYSGVMRYEQNSQYCTSLMSSQIPEVN 534 >SB_14239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Frame = +1 Query: 64 KLPMGS-LYNIINILE---INDSWQKVMAWIPTNPQSDHFHRKYNSEHLRMIQDDAKISK 231 +LP GS YN+ + + +++ Q+ M++ + + +RKY +H + + ++SK Sbjct: 221 ELPKGSECYNLSHSFDRHFVSNPMQEFMSYGKVDFAIERMYRKYQGQHNKQYDSEHEVSK 280 Query: 232 R 234 R Sbjct: 281 R 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,192,096 Number of Sequences: 59808 Number of extensions: 460485 Number of successful extensions: 1046 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2227723674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -