BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0069 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) 37 0.020 SB_21890| Best HMM Match : PDEase_I (HMM E-Value=2.5e-07) 33 0.18 SB_9575| Best HMM Match : PDEase_I (HMM E-Value=0.00012) 33 0.18 SB_20752| Best HMM Match : hATC (HMM E-Value=0.04) 33 0.32 SB_20937| Best HMM Match : hATC (HMM E-Value=0.04) 32 0.42 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_24286| Best HMM Match : DUF1368 (HMM E-Value=4.1) 30 1.7 SB_24284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_20777| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_30167| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11898| Best HMM Match : DMP1 (HMM E-Value=1.6) 30 2.3 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 29 3.9 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 28 6.9 SB_53232| Best HMM Match : OAR (HMM E-Value=0.92) 28 6.9 SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 28 6.9 SB_47440| Best HMM Match : SURF6 (HMM E-Value=0.96) 28 6.9 SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 28 6.9 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_22563| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_10675| Best HMM Match : SURF6 (HMM E-Value=1.3) 28 6.9 SB_57573| Best HMM Match : 7tm_2 (HMM E-Value=3.7e-40) 28 6.9 SB_27561| Best HMM Match : DUF720 (HMM E-Value=0.47) 28 6.9 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 28 9.1 SB_13452| Best HMM Match : Mak16 (HMM E-Value=2.6) 28 9.1 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_23065| Best HMM Match : PID (HMM E-Value=1) 28 9.1 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) Length = 461 Score = 36.7 bits (81), Expect = 0.020 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 4/112 (3%) Frame = +2 Query: 407 KEQRCTVYNSGKNRKSSVQKGRHNPKNCHT*STSKPT--KAEISTNIEALVKDGNLAQAM 580 K+ + KN K SV + + K + K K + ++ + D + + Sbjct: 160 KKSKLGKSKEAKNSKKSVVGKKKHEKKAESKKADKKVSKKVVLMKGVQTVTIDHKTMKII 219 Query: 581 DVLLKSIEVGTMPKSNVVKYL--LKNLAEEGNVEKIQQLGKNISENTKRKVT 730 + KS+ + KS + KYL L+ EGNV+K+++ K ++ KRK T Sbjct: 220 KKIPKSLLHKLLKKSKLDKYLKLASFLSIEGNVKKMKKGSKQAKDSAKRKTT 271 >SB_21890| Best HMM Match : PDEase_I (HMM E-Value=2.5e-07) Length = 229 Score = 33.5 bits (73), Expect = 0.18 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 2/100 (2%) Frame = +3 Query: 333 WTLLQEESEVPSNQFLVYLGNHLKSKNRDVPFIIPEKIEKVQSKKEDIIQKIVTPKVPQ- 509 W L E+S +Q Y + +K + RD IP+K E+ + + ++ Q+ K P+ Sbjct: 124 WQELGEKSM--DDQAKNYSNSPIKERTRDKDVAIPQKKEEPTNDERNVRQQRQKTKSPEN 181 Query: 510 NQQRPKSPQTSRPLLKTE-TWHKQWTSCLNRLK*APCPNR 626 N R +S +TSR K+ + + + + R+K P + Sbjct: 182 NNSRSQSRKTSRDSRKSSGSKRSEKKTSIERMKSLPAQTK 221 >SB_9575| Best HMM Match : PDEase_I (HMM E-Value=0.00012) Length = 286 Score = 33.5 bits (73), Expect = 0.18 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 2/100 (2%) Frame = +3 Query: 333 WTLLQEESEVPSNQFLVYLGNHLKSKNRDVPFIIPEKIEKVQSKKEDIIQKIVTPKVPQ- 509 W L E+S +Q Y + +K + RD IP+K E+ + + ++ Q+ K P+ Sbjct: 96 WQELGEKSM--DDQAKNYSNSPIKERTRDKDVAIPQKKEEPTNDERNVRQQRQKTKSPEN 153 Query: 510 NQQRPKSPQTSRPLLKTE-TWHKQWTSCLNRLK*APCPNR 626 N R +S +TSR K+ + + + + R+K P + Sbjct: 154 NNSRSQSRKTSRDSRKSSGSKRSEKKTSIERMKSLPAQTK 193 >SB_20752| Best HMM Match : hATC (HMM E-Value=0.04) Length = 578 Score = 32.7 bits (71), Expect = 0.32 Identities = 21/99 (21%), Positives = 46/99 (46%) Frame = +2 Query: 440 KNRKSSVQKGRHNPKNCHT*STSKPTKAEISTNIEALVKDGNLAQAMDVLLKSIEVGTMP 619 + RK +V +G + + + + +PTK +E + + + +V + + Sbjct: 42 RERKIAVNQGGNRRGSRNKPTYYEPTKVSAKQRVEEFKGEDLIVRNNEVYCAACKEVVSV 101 Query: 620 KSNVVKYLLKNLAEEGNVEKIQQLGKNISENTKRKVTYD 736 K +++K +K+ E N EK+++LGK + + YD Sbjct: 102 KMSIMKVHVKSKKHELNKEKLKKLGKREEDIVQALHKYD 140 >SB_20937| Best HMM Match : hATC (HMM E-Value=0.04) Length = 606 Score = 32.3 bits (70), Expect = 0.42 Identities = 21/99 (21%), Positives = 46/99 (46%) Frame = +2 Query: 440 KNRKSSVQKGRHNPKNCHT*STSKPTKAEISTNIEALVKDGNLAQAMDVLLKSIEVGTMP 619 + RK +V +G + + + + +PTK +E + + + +V + + Sbjct: 42 RKRKIAVNQGGNRRGSRNKPTYYEPTKVSAKQRVEEFKGEDLIVRNNEVYCAACKEVLSV 101 Query: 620 KSNVVKYLLKNLAEEGNVEKIQQLGKNISENTKRKVTYD 736 K +++K +K+ E N EK+++LGK + + YD Sbjct: 102 KMSIMKVHVKSKKHELNKEKLKKLGKRKEDIVQALHKYD 140 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -1 Query: 161 CRACNPGVSRIRRACL-SLPHST--NASTKSCRMFTSPCICVLKSASHC 24 C AC G+ + C+ S P T + T SC+ C K+ASHC Sbjct: 687 CTACMLGLHLYNKTCVPSCPSGTYLDRDTNSCQQCGQTCQECTKTASHC 735 >SB_24286| Best HMM Match : DUF1368 (HMM E-Value=4.1) Length = 436 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/71 (23%), Positives = 38/71 (53%) Frame = +3 Query: 300 NADETDKALGLWTLLQEESEVPSNQFLVYLGNHLKSKNRDVPFIIPEKIEKVQSKKEDII 479 +++E D+ G T+++ + V + + +L NH K++ ++PE + + SKK I Sbjct: 133 SSEEKDQDGG--TIMELQKHVEFMKSVTFLMNHNKAEENQEEQVVPETVSRAISKKGTEI 190 Query: 480 QKIVTPKVPQN 512 + + ++ QN Sbjct: 191 IRCLFNQLSQN 201 >SB_24284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 29.9 bits (64), Expect = 2.3 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK+ ++G P+ +T K ++ Sbjct: 82 KKRVTDKAKDKLPQTPEKKAEVLETLINSPRTRKTLSRQGVVKTPEEEKESNTLKALASD 141 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 142 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 184 >SB_20777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = +1 Query: 154 ARHRRLDDACQRYVE--EGKSEYLEGLLEATKELSQLIAQTSSTIYSLHTV 300 AR+R+ D C ++ GKS YL+G +E T +L ++ + S+ + T+ Sbjct: 330 ARYRQ-DQHCALEIQCASGKSTYLKGFVELTPDLKEVARRKRSSFFQKKTL 379 >SB_11727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1261 Score = 29.9 bits (64), Expect = 2.3 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 4/84 (4%) Frame = -1 Query: 248 SSFVASSNPSKYSDFPSSTYR*QASSKRLCRACNPGVSRIRRACLSLPHSTNASTKSCRM 69 ++ + P Y PSS ++ Q + CR C P S RR + S+ A +S + Sbjct: 413 ANMCSEMKPRVYRQIPSSDHQDQGHTT--CRTC-PHYSTGRRPLKAQKDSSTAD-RSGQS 468 Query: 68 FTS----PCICVLKSASHCNWLAS 9 F S PC VL + + +W AS Sbjct: 469 FVSTPGSPCYYVLVARDNSHWRAS 492 >SB_30167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 623 SNVVKYLLKNLAEEGNVEKIQQLGKNISENTKRKVTYD 736 SN ++Y+L+++ E I + K+ S KRK+T++ Sbjct: 32 SNEIRYVLRHMGENIPEHDINDILKDASHGRKRKITFE 69 >SB_11898| Best HMM Match : DMP1 (HMM E-Value=1.6) Length = 1705 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 450 KVQSKKEDIIQKIVTPKVPQNQQRPKS 530 K+ K ++ K VTPK+P NQQ+P++ Sbjct: 1326 KLNGKGDESPGKTVTPKLPVNQQQPRN 1352 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 461 QKGRHNPKNCHT*STSKPTKAEISTNIEALVKDGNLAQA 577 ++G H+ + S SKP K +++T A +DG A A Sbjct: 580 RRGSHDKRELFAYSNSKPAKKQLNTKTTAQKRDGKPATA 618 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = +3 Query: 399 LKSKNRDVPFIIPEKIEKVQSKKEDIIQKIV-TPKVPQ-----NQQRPKSPQTSRPLLKT 560 ++SK D I+ ++ E++ S ++ TP PQ N+ R SP++SRPL ++ Sbjct: 255 IESKESDSNVIVNDQFEEIVSGVSNVETSCTSTPSPPQGEVVENETRSGSPKSSRPLARS 314 >SB_895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 348 EESEVPSNQFLVYLGNHLKSKNRDVPF 428 + S +N+ L++ GN KSKN D+PF Sbjct: 156 KRSHAKANKGLLFSGNLNKSKNLDIPF 182 >SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 125 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALASD 184 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 185 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 227 >SB_53232| Best HMM Match : OAR (HMM E-Value=0.92) Length = 806 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 147 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALASD 206 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 207 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 249 >SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 838 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 125 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALASD 184 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 185 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 227 >SB_47440| Best HMM Match : SURF6 (HMM E-Value=0.96) Length = 279 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 57 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALTSD 116 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 117 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 159 >SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 125 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALASD 184 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 185 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 227 >SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +2 Query: 389 RKPFEIKEQRCTVYNSGKNRKSSVQKGRHNPKNCHT*STSKPTKAEISTNIEA 547 R P EIK + T + KN K++V + +NP +TS P ++S +A Sbjct: 335 RSPQEIKLEIKTEAETTKNTKTAVVRPGYNPFEDEDEATSPPPLPDVSDKKQA 387 >SB_22563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 578 MDVLLKSIEVGTMPKSNVVKYLLKNLAEEGNVEKIQQLG 694 MDVL +++E+G +P VV + LA +V + QLG Sbjct: 280 MDVLERTVELGRLP---VVNFAAGGLATPADVSLLMQLG 315 >SB_10675| Best HMM Match : SURF6 (HMM E-Value=1.3) Length = 244 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 22 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALTSD 81 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 82 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 124 >SB_57573| Best HMM Match : 7tm_2 (HMM E-Value=3.7e-40) Length = 956 Score = 28.3 bits (60), Expect = 6.9 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 3/103 (2%) Frame = +2 Query: 350 RKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKG-RHNPKNCHT*STSKPTKAE 526 +KR T+ LP+ P + E T+ NS + RK ++G P+ +T K ++ Sbjct: 811 KKRVTDKVKDKLPQTPEKKAEVLETLINSPRTRKILSRQGVVKTPEEEKESNTLKALASD 870 Query: 527 ISTNIEALVKDG-NLAQAMDVLLKSIEVG-TMPKSNVVKYLLK 649 IS ++ + + G N +A LKS+ G + KS K L K Sbjct: 871 ISEGLKHVKRSGSNEKRAAYKALKSLAFGDNIKKSRAKKSLGK 913 >SB_27561| Best HMM Match : DUF720 (HMM E-Value=0.47) Length = 779 Score = 28.3 bits (60), Expect = 6.9 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Frame = +3 Query: 327 GLWTLLQEESEVPSNQFLVYLGNHLKSKNRDVPFIIPEKIEKVQSKKEDIIQKIVTPKVP 506 G W ++ + + LV L ++ KS + P I P + V +K+D +I TP+ Sbjct: 131 GKWLIVIVVQVIKAALRLVLLFSY-KSGIQRAPLIPPLDRKSVFPEKQDGENEIKTPEEE 189 Query: 507 QNQQRPKSP-----QTSRPLLK 557 + + P+SP +T RP+ K Sbjct: 190 KKPKEPQSPVWKGTRTGRPMRK 211 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 27.9 bits (59), Expect = 9.1 Identities = 23/62 (37%), Positives = 27/62 (43%) Frame = -2 Query: 220 PSTLISLPQRIADKRHPSVCVEPAILVFREYDVPVSVFRTQRTQVLNHVECLLHRVSVYL 41 PS +SL Q I HPSV V ++ VSV Q H+ CL VSV L Sbjct: 344 PSVSVSLGQSIWYHTHPSVSVSLGQSIWYHTHPSVSVSLGQSIWYHTHLVCL---VSVSL 400 Query: 40 NQ 35 Q Sbjct: 401 GQ 402 >SB_13452| Best HMM Match : Mak16 (HMM E-Value=2.6) Length = 163 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 226 ILPSTLISLPQRIADKRHPSVCVEPAILVFREYDVPVSVFRTQRTQVL 83 +LP T+ +L + IA R+ + V P+I R Y+V + RT L Sbjct: 39 LLPQTVHTLRRGIARSRNITSTVTPSIEPERHYNVSICPINRTRTAAL 86 >SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/64 (23%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = +3 Query: 399 LKSKNRDVPFIIPEKIEKVQSKKEDIIQKIVTPKVPQNQQRPKSPQT----SRPLLKTET 566 +K +++DVPF+ E + +++K++ K + K P+N + ++ + R + Sbjct: 4 MKVRDKDVPFMTSEWKQTIRAKRK-ATSKFLKNKTPENWENKRAARNEATRQRRIAIKHY 62 Query: 567 WHKQ 578 W KQ Sbjct: 63 WRKQ 66 >SB_23065| Best HMM Match : PID (HMM E-Value=1) Length = 141 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +2 Query: 374 ISCLPRKPFEIKEQRCTVYNSGKNRKSS--VQKGRHNPKNCHT*STSKPTKAEIST 535 ++C+PR+ +E CTV N G + +S Q+ R+N + ++ + S+ K ST Sbjct: 4 LACIPRRGRGSQEDTCTVRNLGCSTATSPGAQEMRNNMDSFYSMTRSRSRKMLKST 59 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 27.9 bits (59), Expect = 9.1 Identities = 29/117 (24%), Positives = 51/117 (43%) Frame = +2 Query: 332 MDTASRRKRSTE*PISCLPRKPFEIKEQRCTVYNSGKNRKSSVQKGRHNPKNCHT*STSK 511 +D+A+ + + I L ++E C + N + +++ + N K + Sbjct: 738 VDSATGESQEMKHKIHTLAESLKSVQESVCDLEIERDNLQLDLEESKKNEKELR--AVIV 795 Query: 512 PTKAEISTNIEALVKDGNLAQAMDVLLKSIEVGTMPKSNVVKYLLKNLAEEGNVEKI 682 K E S+ + LVK +LAQ + LK +++ K LK+ EE N EKI Sbjct: 796 QLKRENSSTRDKLVKANDLAQTLQDCLK--------EAHDEKEDLKDSLEEANDEKI 844 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,506,114 Number of Sequences: 59808 Number of extensions: 484746 Number of successful extensions: 1771 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 1596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1767 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -