BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0066 (557 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25520.1 68417.m03680 transcriptional co-regulator family pro... 33 0.13 At1g56040.1 68414.m06434 U-box domain-containing protein contain... 31 0.52 At1g48310.1 68414.m05396 SNF2 domain-containing protein / helica... 29 2.1 At4g23780.1 68417.m03420 hypothetical protein 29 2.8 At5g13100.1 68418.m01501 expressed protein 28 3.7 At2g36200.1 68415.m04444 kinesin motor protein-related 28 3.7 At4g25515.1 68417.m03679 transcriptional co-regulator family pro... 28 4.9 At2g41130.1 68415.m05080 basic helix-loop-helix (bHLH) family pr... 28 4.9 At5g39750.1 68418.m04815 MADS-box family protein contains Pfam p... 27 6.4 At5g17760.2 68418.m02083 AAA-type ATPase family protein contains... 27 6.4 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 27 6.4 At4g39170.1 68417.m05547 SEC14 cytosolic factor, putative / phos... 27 6.4 At3g06290.1 68416.m00722 SAC3/GANP family protein contains Pfam ... 27 6.4 At2g37630.1 68415.m04616 myb family transcription factor (MYB91)... 27 6.4 At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TO... 27 8.5 At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TO... 27 8.5 At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TO... 27 8.5 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 27 8.5 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 27 8.5 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 27 8.5 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 27 8.5 At1g48900.1 68414.m05478 signal recognition particle 54 kDa prot... 27 8.5 >At4g25520.1 68417.m03680 transcriptional co-regulator family protein contains similarity to GP|18033922|gb|AAL57277 SEUSS transcriptional co-regulator [Arabidopsis thaliana] Length = 748 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +3 Query: 171 QDSAQGGEHRGTPQCQPRKGT*PH--GEAPDQLQLHQFLQDCDELGEWVQEK 320 Q G PQ P + PH G P+Q LHQ LQ+ E G VQ++ Sbjct: 624 QQRTMNGPTNILPQNHPHQLQSPHSHGNTPEQQMLHQLLQEMSENGGSVQQQ 675 >At1g56040.1 68414.m06434 U-box domain-containing protein contains Pfam profile PF04564: U-box domain Length = 437 Score = 31.1 bits (67), Expect = 0.52 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = +1 Query: 28 PPTNLEQAENIIKEHEAFLTTMEANDDKINSVVQFANRLVE-ERHFDAD-KIQRKAENIE 201 PP + A N+ + L +D+K N +V+ ++R+VE E +++ + K++++AE+ Sbjct: 104 PPERITDAMNLFRSIIGKLADFHFSDEKFNQLVR-SSRVVELEGNYNEEVKLRKEAEDAL 162 Query: 202 ARRNANREKALNLME 246 A + + E L+E Sbjct: 163 AMKKEDVEMMEQLLE 177 >At1g48310.1 68414.m05396 SNF2 domain-containing protein / helicase domain-containing protein contains similarity to DNA-dependent ATPase A GI:6651385 from [Bos taurus]}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 Length = 673 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 22 TEPPTNLEQAENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERH 159 T P ++L AENI++E + +E D + + A+R+ + RH Sbjct: 114 TFPHSSLSSAENILREISSVKVEIENLDPLVQRAIASASRVPDLRH 159 >At4g23780.1 68417.m03420 hypothetical protein Length = 148 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/69 (20%), Positives = 34/69 (49%) Frame = +1 Query: 4 EHRLAKTEPPTNLEQAENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERHFDADKIQR 183 +H + K + + + + EN++KEHE + T+E + ++ + E ++I++ Sbjct: 24 QHEIWKEKYESLVTEHENLVKEHETLIKTLELIEKHEITLEDLVKKKQREALVGKEEIEK 83 Query: 184 KAENIEARR 210 + I R+ Sbjct: 84 FDKEIGERK 92 >At5g13100.1 68418.m01501 expressed protein Length = 354 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +3 Query: 267 LHQFLQDCDELGEWVQEKNVTAQDDTYRSAKTIHSKWTRHQAFEAEIAANKERLFAVQNA 446 + +FL+D E +EK V + + + S W H E ++ A K+ ++ +A Sbjct: 137 VRRFLEDFRSASE--EEKEVITDAIRHMYSPDLKSGWGIHIVQEEKLLAKKDERESLDSA 194 Query: 447 AEELMK 464 EEL++ Sbjct: 195 IEELLQ 200 >At2g36200.1 68415.m04444 kinesin motor protein-related Length = 1056 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 94 EANDDKINSVVQFANRLVEERHFDADKIQRKAENI 198 EAND +INS++ F + D DK+ N+ Sbjct: 709 EANDSQINSIIDFQKTYEAQSKSDTDKLIADLTNL 743 >At4g25515.1 68417.m03679 transcriptional co-regulator family protein contains similarity to GP|18033922|gb|AAL57277 SEUSS transcriptional co-regulator [Arabidopsis thaliana] Length = 471 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 207 PQCQPRKGT*PH--GEAPDQLQLHQFLQDCDELGEWVQEK 320 PQ P + PH G +Q LHQ LQ+ E G V+++ Sbjct: 359 PQNHPHQLQSPHSHGNTQEQQMLHQLLQEMTENGASVEQQ 398 >At2g41130.1 68415.m05080 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 253 Score = 27.9 bits (59), Expect = 4.9 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 1/77 (1%) Frame = +1 Query: 199 EARRNANREKALNLMEKLQTSFSCTSSCRTATNLENGFRR-RTLPHKTIPTAPPRLSTLS 375 EA R RE+ + + KL+ SC S AT L +R R L +T+ T+ + L Sbjct: 73 EAERR-RRERINSHLNKLRNVLSCNSKTDKATLLAKVVQRVRELKQQTLETSDSDQTLLP 131 Query: 376 GPVIRLSKLKLRPTKND 426 +S L ND Sbjct: 132 SETDEISVLHFGDYSND 148 >At5g39750.1 68418.m04815 MADS-box family protein contains Pfam profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); MADS-box protein AGL81 Length = 355 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -1 Query: 188 ALR*ILSASKCLSSTRRLANCTTELILSSLASIVVRKAS--CSLIIFSACSKFVG 30 A+R + S+S+C SS+ + LS+ + +KAS C+L AC + G Sbjct: 2 AIRSLPSSSRCSSSSSSSSYSLASTSLSNRLETIFKKASELCTLCDIEACVIYYG 56 >At5g17760.2 68418.m02083 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 341 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 52 ENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERHF 162 E++I EH + TM DD V++ +R + + F Sbjct: 208 ESVILEHPSTFETMAMEDDLKRDVIEDLDRFIRRKEF 244 >At5g17760.1 68418.m02082 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 505 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 52 ENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERHF 162 E++I EH + TM DD V++ +R + + F Sbjct: 208 ESVILEHPSTFETMAMEDDLKRDVIEDLDRFIRRKEF 244 >At4g39170.1 68417.m05547 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus] and phosphatidylinositol-phosphatidylcholine transfer protein SEC14, Yarrowia lipolytica, PIR2:S43745;contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 614 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/65 (26%), Positives = 29/65 (44%) Frame = +3 Query: 267 LHQFLQDCDELGEWVQEKNVTAQDDTYRSAKTIHSKWTRHQAFEAEIAANKERLFAVQNA 446 L+ L+ EL E + + Y + +++ R A EAE+ A K+ L+ Sbjct: 527 LNSVLKKLTELEEKIGALQSKPSEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMR 586 Query: 447 AEELM 461 EEL+ Sbjct: 587 QEELL 591 >At3g06290.1 68416.m00722 SAC3/GANP family protein contains Pfam profile: PF03399 SAC3/GANP family Length = 1720 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = +3 Query: 324 VTAQDDTYRSAKTIHSKWTRHQAFEAEIAANKERLFAVQNAAEELMKQKPEFVEVISPKM 503 +TA A+++ K T + F+ E+A +K L A ++ P VI+P + Sbjct: 874 ITAHKHEMPPARSL-KKQTSMRLFDKEVADSKTSLLAEEDKPMGTFVMNPPGPFVINPVV 932 Query: 504 HDSKIN 521 H K N Sbjct: 933 HQEKQN 938 >At2g37630.1 68415.m04616 myb family transcription factor (MYB91) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 367 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 178 QRKAENIEARRNANREKALNLMEKLQTSF 264 + K E IEA+ A RE+ N MEK++ + Sbjct: 295 REKMEEIEAKMKALREEQKNAMEKIEGEY 323 >At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 487 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +1 Query: 37 NLEQAENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERHFDADKIQRKAENIEARRNA 216 N+E ++I + T + +DDK+ + + EE D I K ++++ + Sbjct: 215 NMEDHQDIGESKSVDTTNRKLDDDKVVVKEERGDSEKEEEGETGDLISEKTDSVDIHKKE 274 Query: 217 NREKALN 237 + K +N Sbjct: 275 DETKPIN 281 >At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +1 Query: 37 NLEQAENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERHFDADKIQRKAENIEARRNA 216 N+E ++I + T + +DDK+ + + EE D I K ++++ + Sbjct: 215 NMEDHQDIGESKSVDTTNRKLDDDKVVVKEERGDSEKEEEGETGDLISEKTDSVDIHKKE 274 Query: 217 NREKALN 237 + K +N Sbjct: 275 DETKPIN 281 >At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +1 Query: 37 NLEQAENIIKEHEAFLTTMEANDDKINSVVQFANRLVEERHFDADKIQRKAENIEARRNA 216 N+E ++I + T + +DDK+ + + EE D I K ++++ + Sbjct: 215 NMEDHQDIGESKSVDTTNRKLDDDKVVVKEERGDSEKEEEGETGDLISEKTDSVDIHKKE 274 Query: 217 NREKALN 237 + K +N Sbjct: 275 DETKPIN 281 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 259 SFSCTSSCRTATNLENGFRRRTLPHKTIPTAPPRLSTLS 375 S + TSS T ++ + R +L +P +PPR++T++ Sbjct: 132 SSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVT 170 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 259 SFSCTSSCRTATNLENGFRRRTLPHKTIPTAPPRLSTLS 375 S + TSS T ++ + R +L +P +PPR++T++ Sbjct: 154 SSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVT 192 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 259 SFSCTSSCRTATNLENGFRRRTLPHKTIPTAPPRLSTLS 375 S + TSS T ++ + R +L +P +PPR++T++ Sbjct: 132 SSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVT 170 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 259 SFSCTSSCRTATNLENGFRRRTLPHKTIPTAPPRLSTLS 375 S + TSS T ++ + R +L +P +PPR++T++ Sbjct: 132 SSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVT 170 >At1g48900.1 68414.m05478 signal recognition particle 54 kDa protein 3 / SRP54 (SRP-54C) identical to SP|P49967 Signal recognition particle 54 kDa protein 3 (SRP54) {Arabidopsis thaliana} Length = 495 Score = 27.1 bits (57), Expect = 8.5 Identities = 21/90 (23%), Positives = 41/90 (45%) Frame = -3 Query: 273 GATEAGLELLHEVKCLFAVGIAACLDVLRLALNLVRVEVPLLDEAISELHN*INLIVISL 94 G ++ + V + + CL+ + AL V PL+ E S + +NL ++ Sbjct: 8 GRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIVNLEDLAA 67 Query: 93 HRSEEGLVFLDNIFSLFQVCRRLGFGEPVF 4 ++ ++ IFS ++C+ L G+P F Sbjct: 68 GHNKRRII-EQAIFS--ELCKMLDPGKPAF 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,170,524 Number of Sequences: 28952 Number of extensions: 240831 Number of successful extensions: 1006 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -