BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0063 (785 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccha... 30 0.33 SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 30 0.43 SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subun... 27 3.0 >SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1011 Score = 30.3 bits (65), Expect = 0.33 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 459 IFITRCYSFVVNVHFTYIASSVHRARVEDMALVD-YGLEELMRAAGLGRQ 313 +FIT + V V IA S+HR E L + + + EL R G RQ Sbjct: 370 LFITSIMNLVEKVLMQLIAMSLHRREYESRILYNKFAINELARLYGYARQ 419 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 29.9 bits (64), Expect = 0.43 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = -2 Query: 751 VVGPLVSLHG*VPSPFCREAVMRFGLKGGAAVVTILETLELISQGG 614 V+ + L+ PS F E V+ L GG AVV + TLE I Q G Sbjct: 78 VIDKALMLYFKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 >SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subunit Rpc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1165 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 6 THKCIGLSRRENEIEHIIWKHKVHVIDPGI 95 TH IG +R+ E ++WKH V V D G+ Sbjct: 815 THDRIGDPQRDPETGEVVWKHGV-VEDDGL 843 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,440,769 Number of Sequences: 5004 Number of extensions: 76119 Number of successful extensions: 137 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -