BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0062 (766 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 4.7 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 6.2 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 655 MWCSPSSPNFTRPGWSTAPGRRKMTTSRTSCNQTESS 765 +W S S R +APG+R SR N + + Sbjct: 230 IWQSSESSLRPRSSQKSAPGKRTPLISRAKINTVKQT 266 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 94 NEFGHHSTDSFNTHGQRVDI 35 +E G+H+ +S + G+ VDI Sbjct: 41 DEEGYHTPESLHYEGRAVDI 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,249 Number of Sequences: 336 Number of extensions: 3225 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -