BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0061 (506 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 26 0.17 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 22 2.7 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 22 2.7 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 4.8 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 6.3 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 26.2 bits (55), Expect = 0.17 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 270 DKKEVWSG-AGSATSAAFK-VKKGGRYQMQVELCNSDGCS 383 +K E++ G T++ F+ VK G Y + C+S GCS Sbjct: 317 NKTEIFLNITGDKTNSVFEHVKLGSLYHISFMACSSAGCS 356 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 22.2 bits (45), Expect = 2.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 199 DAADVSVNWNVWTGDAA 249 D + V WN W G+A+ Sbjct: 104 DESKCDVFWNCWNGEAS 120 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 22.2 bits (45), Expect = 2.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 199 DAADVSVNWNVWTGDAA 249 D + V WN W G+A+ Sbjct: 104 DESKCDVFWNCWNGEAS 120 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.4 bits (43), Expect = 4.8 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 450 NNREASNGYHQCQLLRFRCP 391 NNR N Y C L + CP Sbjct: 35 NNRRMVNYYAACLLSKGPCP 54 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 6.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 300 SATSAAFKVKKGGRYQMQVELC 365 SA S K KKG + Q ELC Sbjct: 167 SADSCDSKKKKGPTPRQQEELC 188 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,968 Number of Sequences: 336 Number of extensions: 1841 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -