BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0059 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.3 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.0 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 4.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 4.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 4.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 4.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 4.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 4.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 4.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 4.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 4.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 4.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 5.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.1 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 109 PISYFWLCLAMMCLCSAYIFM 47 P+SY A M +C+ ++FM Sbjct: 300 PVSYLKAVDAFMSVCTVFVFM 320 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 254 LSPANVKLPEQVDWRK 301 L P+N KLP +W+K Sbjct: 385 LDPSNRKLPAPANWKK 400 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 480 SPPLQPLFPYCSEQSMRFCS 421 SPPL FP + + ++ CS Sbjct: 172 SPPLLGCFPRATNRDIKKCS 191 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +2 Query: 122 QAGHEQVRRHAPPRVREDYERLQQNCQTQQESVHEGWER 238 Q+ H Q + A P+ ++ ++ Q Q QQ+ + +R Sbjct: 818 QSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQQQR 856 Score = 23.0 bits (47), Expect = 3.0 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +2 Query: 437 DCSEQ-YGNNGCNGGLMDNAFKYIKTTGASTPSRP-TPTRELTTSAGTIPRTP 589 D SE Y +G NG +DN + TG R T R A + + P Sbjct: 1268 DVSEGIYDGSGANGSFLDNLIRSSLETGIPRDQRAMTEARNQQQQASSQQQIP 1320 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -1 Query: 677 TETGPTVATASISFCSSPSGMSTKPTSSAPV 585 ++ P +A +S SP+G P++ AP+ Sbjct: 387 SQVSPVSMSALVSAVRSPAGGQLPPSAGAPM 417 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 121 HIGPLTPFPPRFIPPDMYR 139 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 369 HIGPLTPFPPRFIPPDMYR 387 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 354 HIGPLTPFPPRFIPPDMYR 372 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 271 HVGRR*NLAPRTLPPFMYR 215 H+G PR +PP MYR Sbjct: 370 HIGPLTPFPPRFIPPDMYR 388 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 147 DMLHHEFVKTMNGFNKTAKHNKNLYMKGG 233 D H+ + NG + T HN+ L GG Sbjct: 395 DSARHQRIGGCNGLHTTTAHNRFLGGIGG 423 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +2 Query: 125 AGHEQVRRHAPPRVREDYERLQQNCQTQQESVHEGWER 238 AG++ RRH V E Y+ N + ++ +R Sbjct: 26 AGYKHSRRHRDFTVAESYDASSSNSDSLSMTIPPSIDR 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,280 Number of Sequences: 438 Number of extensions: 4566 Number of successful extensions: 29 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -