BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0058 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 27 0.13 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 27 0.13 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 8.9 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 27.5 bits (58), Expect = 0.13 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 173 EDNVSTSNCYGILFTKSSFLNICSQISS**FEHNFSLYK 57 E +VS+ +G+LF SFL +++ F H + +Y+ Sbjct: 10 ESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYE 48 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 27.5 bits (58), Expect = 0.13 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 173 EDNVSTSNCYGILFTKSSFLNICSQISS**FEHNFSLYK 57 E +VS+ +G+LF SFL +++ F H + +Y+ Sbjct: 10 ESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYE 48 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 55 TLYKEKLCSNHYELICEQILRNEDLVNNIP*QFEV 159 TL+ L S + +ILR+E+L N +F++ Sbjct: 273 TLFFHPLSSRREFAVSTRILRDENLSQNSYHEFQI 307 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,676 Number of Sequences: 438 Number of extensions: 3874 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -