BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0057 (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 79 2e-15 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 79 4e-15 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 79 4e-15 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 76 2e-14 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 76 2e-14 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 73 2e-13 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 69 5e-12 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 62 4e-10 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 62 4e-10 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 62 4e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 58 6e-09 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 55 5e-08 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 54 1e-07 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 43 2e-04 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 42 3e-04 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 40 0.001 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 40 0.002 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 40 0.002 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.013 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 37 0.013 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.013 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.013 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.017 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 36 0.023 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 36 0.030 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 36 0.030 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.030 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 35 0.052 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 35 0.052 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 35 0.069 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 35 0.069 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 34 0.091 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 33 0.16 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 33 0.21 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 33 0.28 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 33 0.28 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 33 0.28 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 33 0.28 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.28 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 33 0.28 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 33 0.28 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 33 0.28 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 32 0.37 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.37 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 32 0.49 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 31 0.64 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 31 0.64 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 31 0.64 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 0.85 At3g19780.1 68416.m02504 expressed protein 31 0.85 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.85 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 1.1 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 31 1.1 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 30 2.0 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 2.0 At1g04700.1 68414.m00467 protein kinase family protein low simil... 30 2.0 At4g05490.1 68417.m00830 F-box family protein (FBL22) contains s... 29 2.6 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 29 2.6 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 3.4 At1g26680.1 68414.m03250 transcriptional factor B3 family protei... 29 4.5 At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ... 28 6.0 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 6.0 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 7.9 At2g27350.3 68415.m03293 OTU-like cysteine protease family prote... 28 7.9 At2g27350.2 68415.m03292 OTU-like cysteine protease family prote... 28 7.9 At2g27350.1 68415.m03291 OTU-like cysteine protease family prote... 28 7.9 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 79.4 bits (187), Expect = 2e-15 Identities = 36/87 (41%), Positives = 62/87 (71%), Gaps = 4/87 (4%) Frame = +2 Query: 248 QGTTKLAEEESPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQAD 415 + ++L+ P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ Sbjct: 70 KAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAE 129 Query: 416 DIISWLKKKTGPPAVEVTSAEQAKELI 496 I+++LKK++GP +VE+ SA+ A E++ Sbjct: 130 GIVTYLKKQSGPASVEIKSADSATEVV 156 Score = 66.9 bits (156), Expect = 1e-11 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 72 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 245 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 246 AKA 254 KA Sbjct: 69 EKA 71 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 114 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 239 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/60 (28%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 445 + + + +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 420 QNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 78.6 bits (185), Expect = 4e-15 Identities = 33/83 (39%), Positives = 56/83 (67%) Frame = +2 Query: 272 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 451 +E + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 150 KEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGP 209 Query: 452 PAVEVTSAEQAKELIDANTLLYL 520 +T+ + A++++ + + L Sbjct: 210 GVYNLTTLDDAEKVLTSGNKVVL 232 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 4/59 (6%) Frame = +3 Query: 90 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 254 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA A Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAA 145 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 3/51 (5%) Frame = +3 Query: 108 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAK 251 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNK 483 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 78.6 bits (185), Expect = 4e-15 Identities = 33/83 (39%), Positives = 56/83 (67%) Frame = +2 Query: 272 EESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 451 +E + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 150 KEDGVVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGP 209 Query: 452 PAVEVTSAEQAKELIDANTLLYL 520 +T+ + A++++ + + L Sbjct: 210 GVYNLTTLDDAEKVLTSGNKVVL 232 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 4/59 (6%) Frame = +3 Query: 90 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 254 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA A Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAA 145 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 3/51 (5%) Frame = +3 Query: 108 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAK 251 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNK 483 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 76.2 bits (179), Expect = 2e-14 Identities = 34/87 (39%), Positives = 60/87 (68%), Gaps = 4/87 (4%) Frame = +2 Query: 248 QGTTKLAEEESPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQAD 415 + + L+ P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ Sbjct: 71 KAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAE 130 Query: 416 DIISWLKKKTGPPAVEVTSAEQAKELI 496 I+++LKK++GP + E+ SA+ A E++ Sbjct: 131 GIVTYLKKQSGPASAEIKSADDASEVV 157 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 6/67 (8%) Frame = +3 Query: 72 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 233 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 234 APEYAKA 254 APEY KA Sbjct: 66 APEYEKA 72 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 114 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 239 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/57 (28%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 436 + +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 422 QSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 76.2 bits (179), Expect = 2e-14 Identities = 34/87 (39%), Positives = 60/87 (68%), Gaps = 4/87 (4%) Frame = +2 Query: 248 QGTTKLAEEESPIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQAD 415 + + L+ P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ Sbjct: 71 KAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAE 130 Query: 416 DIISWLKKKTGPPAVEVTSAEQAKELI 496 I+++LKK++GP + E+ SA+ A E++ Sbjct: 131 GIVTYLKKQSGPASAEIKSADDASEVV 157 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 6/67 (8%) Frame = +3 Query: 72 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 233 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 234 APEYAKA 254 APEY KA Sbjct: 66 APEYEKA 72 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 114 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 239 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 4/78 (5%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK- 442 + +S + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 422 QSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNK 481 Query: 443 --TGPPAVEVTSAEQAKE 490 G P E + E+ K+ Sbjct: 482 DTVGEPKKEEETTEEVKD 499 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 72.9 bits (171), Expect = 2e-13 Identities = 29/84 (34%), Positives = 51/84 (60%) Frame = +2 Query: 248 QGTTKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 427 + T L E S + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ Sbjct: 118 EAATALKEIGSSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVI 177 Query: 428 WLKKKTGPPAVEVTSAEQAKELID 499 W++KKTG P + + + ++A +D Sbjct: 178 WVQKKTGAPIITLNTVDEAPRFLD 201 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 132 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 254 VL L+ + VI E+++V YAPWC L P +A+A Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEA 119 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 68.5 bits (160), Expect = 5e-12 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = +2 Query: 290 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEV 466 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 467 TSAEQAKELIDANTLL 514 T+ E+A+ ++ A L Sbjct: 211 TTKEEAERVLSAEPKL 226 Score = 58.0 bits (134), Expect = 6e-09 Identities = 23/44 (52%), Positives = 31/44 (70%) Frame = +3 Query: 123 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 254 E++V VL+K NF + + +VEFYAPWCG C++L PEYA A Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAA 141 Score = 47.2 bits (107), Expect = 1e-05 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +3 Query: 45 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 215 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 216 GHCKSLAPEYAK 251 GHC+S P Y K Sbjct: 468 GHCQSFEPIYNK 479 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 4/89 (4%) Frame = +1 Query: 511 IVFGFFSDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDE----DVVLFKNFEE 678 +VFGF + + ++ + +++ DD F + + K E E + +VL K EE Sbjct: 226 LVFGFLNSLVGSESEELAAASRLEDDLSFYQTASPDIAKLFEIETQVKRPALVLLKKEEE 285 Query: 679 KRVKYEDEEITEDLLNAWVFVQSMPTIVN 765 K ++ D T+ + +V +P ++N Sbjct: 286 KLARF-DGNFTKTAIAEFVSANKVPLVIN 313 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 62.1 bits (144), Expect = 4e-10 Identities = 25/79 (31%), Positives = 48/79 (60%) Frame = +2 Query: 248 QGTTKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 427 + T L E S + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ Sbjct: 116 EAATDLKEIGSSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVI 175 Query: 428 WLKKKTGPPAVEVTSAEQA 484 W++KKTG +++ + ++A Sbjct: 176 WVQKKTGASTIKLDTVDEA 194 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 132 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 254 V+ L+ N + +I EY++V YAPWC L P +A+A Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEA 117 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 62.1 bits (144), Expect = 4e-10 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = +3 Query: 69 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 248 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 249 KAQQSW 266 K S+ Sbjct: 64 KLGASF 69 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 126 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAK 251 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEK 183 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKK 442 ++E + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K Sbjct: 189 KQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEK 248 Query: 443 TG 448 +G Sbjct: 249 SG 250 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 284 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 448 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 62.1 bits (144), Expect = 4e-10 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = +3 Query: 69 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 248 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 249 KAQQSW 266 K S+ Sbjct: 64 KLGASF 69 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 126 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAK 251 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEK 183 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKK 442 ++E + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K Sbjct: 189 KQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEK 248 Query: 443 TG 448 +G Sbjct: 249 SG 250 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 284 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 448 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 58.0 bits (134), Expect = 6e-09 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 108 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPE 242 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPE 70 Score = 56.8 bits (131), Expect = 1e-08 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +2 Query: 263 LAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 442 LA+ + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK Sbjct: 78 LAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKF 137 Query: 443 TGPPAVEVTSAEQAKELI-DANT 508 P + S KE + DA T Sbjct: 138 VAPDVAVLESDSTVKEFVEDAGT 160 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 55.2 bits (127), Expect = 5e-08 Identities = 21/39 (53%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +3 Query: 141 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKA 254 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KA Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKA 206 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/41 (51%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +3 Query: 132 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAK 251 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P + K Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEK 70 Score = 47.6 bits (108), Expect(2) = 4e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 290 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 442 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 6/88 (6%) Frame = +2 Query: 284 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LKKKT 445 +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ L+ Sbjct: 214 VKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNA 273 Query: 446 GPPAVEVTSAEQAKELIDANTLLYLVSF 529 GP V + E + + VSF Sbjct: 274 GPAEVTELTGPDVMEDKCGSAAICFVSF 301 Score = 20.6 bits (41), Expect(2) = 4e-06 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 434 KKKTGPPAVEVTSAEQAKELIDANTLLYLVSF 529 KKK+ P A ++ EL+ + L++V F Sbjct: 157 KKKSEPSASVELNSSNFDELVTESKELWIVEF 188 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 53.6 bits (123), Expect = 1e-07 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +3 Query: 141 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAQQS 263 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +A ++ Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKN 208 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/41 (48%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +3 Query: 132 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAK 251 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P + K Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEK 72 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 290 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 442 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 36.3 bits (80), Expect = 0.023 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 6/91 (6%) Frame = +2 Query: 275 ESPIKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISW----LK 436 + +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ ++ Sbjct: 210 QGKVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVE 269 Query: 437 KKTGPPAVEVTSAEQAKELIDANTLLYLVSF 529 GP V + E + + +SF Sbjct: 270 SSAGPVEVTELTGPDVMEKKCGSAAICFISF 300 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 2/75 (2%) Frame = +3 Query: 48 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 221 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 222 CKSLAPEYAKAQQSW 266 C+ LAP+ K +Q + Sbjct: 153 CRELAPDVYKIEQQY 167 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 388 E + + LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 194 EMDGRVILAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 105 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKA 254 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KA Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKA 183 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 123 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAK 251 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEK 78 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 123 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAK 251 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEK 84 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 123 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAK 251 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEK 84 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +3 Query: 120 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 239 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 10/71 (14%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADD 418 E + + L VD T+E L + ++GYP+++ FR GS + Y G R D Sbjct: 194 EADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDS 253 Query: 419 IISWLKKKTGP 451 I+ ++ P Sbjct: 254 IVKMVEGLVAP 264 Score = 35.1 bits (77), Expect = 0.052 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 75 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 248 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 249 KA 254 KA Sbjct: 182 KA 183 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +3 Query: 141 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 239 LS + ++T + ++ +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 287 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 391 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.013 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 296 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 448 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +2 Query: 284 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 433 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 434 KKKTGP 451 ++ P Sbjct: 260 EELLKP 265 Score = 35.5 bits (78), Expect = 0.040 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 141 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAQQ 260 L+ A FE + ++V FYAPWC L P + KA Q Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQ 186 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 120 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 239 T + V++ + +++ V+ E + V+F+APWCG CK + P Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDP 112 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 35.9 bits (79), Expect = 0.030 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +2 Query: 296 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 475 +V+A + +++E+Y V P FF++G +D G AD S L K G A TSA Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112 Query: 476 EQA 484 E A Sbjct: 113 EPA 115 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.9 bits (79), Expect = 0.030 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 162 TVITTTEYILVEFYAPWCGHCKSLAPEYAKAQQSW 266 TV+ + + +LVEF A WCG CK + P Q + Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEY 116 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.030 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 335 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 484 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.1 bits (77), Expect = 0.052 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +3 Query: 111 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAQQS 263 E T N+L + AN ++++ + ++V +FY+P CG CKSL P+ + ++ Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLAET 133 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 257 TKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 391 + LA + S + KVD + D+A S+ + PT F R+G +D Sbjct: 315 SNLATQHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 34.7 bits (76), Expect = 0.069 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 147 KANFETVITTTEYILVEFYAPWCGHCKSLAPE 242 K+ + T + +++EF A WCG CK+L P+ Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPK 80 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 34.7 bits (76), Expect = 0.069 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +3 Query: 111 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEY 245 E+ NV+ LSK E ++ E LV YAPWC C+++ Y Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASY 384 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 34.3 bits (75), Expect = 0.091 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +2 Query: 260 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 439 ++A++ + + K+D + Q +A+ + V PT F + G+ ID G D+I L K Sbjct: 51 EMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMK 110 Query: 440 KTG 448 G Sbjct: 111 HGG 113 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAK 251 I+++F A WC C+ +AP +A+ Sbjct: 30 IVIDFTASWCPPCRFIAPVFAE 51 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.5 bits (73), Expect = 0.16 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAKAQQSW 266 ++++ Y WCG CK +AP+Y + + + Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEKY 126 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 260 KLAEEESPIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 427 +L+E+ + K+D Q+ + LA+ G+R PT K ++ + G + +D+++ Sbjct: 121 ELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLA 177 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 33.1 bits (72), Expect = 0.21 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAK 251 ++V+FY WCG C+++ P+ K Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCK 137 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 428 WLKKKTGPPAVEVTSAEQ-AKELIDANTLLYLVSF 529 W ++K GP +++TSAEQ L DA L +V F Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDF 120 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 32.7 bits (71), Expect = 0.28 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAK 251 ++VEFY WC C++L P+ K Sbjct: 126 VIVEFYGTWCASCRALFPKLCK 147 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 32.7 bits (71), Expect = 0.28 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAK 251 ++VEFY WC C++L P+ K Sbjct: 126 VIVEFYGTWCASCRALFPKLCK 147 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/59 (25%), Positives = 30/59 (50%) Frame = +2 Query: 263 LAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 439 LA++ + KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 53 LAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYA 248 ++V+F A WCG C+ +AP +A Sbjct: 31 VVVDFTASWCGPCRFIAPFFA 51 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 32.7 bits (71), Expect = 0.28 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAKAQQSW 266 ++++ Y WCG CK +AP+Y + + Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKALSEKY 116 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 263 LAEEESPIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 427 L+E+ + K+D + + LA+ G+R PT K ++ + G + DD+++ Sbjct: 112 LSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVA 167 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.28 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 153 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 239 +FE ++ ++ +LV++YA WCG C+ + P Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 284 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 424 I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 260 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 436 K E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 437 KKTGPPAVEVTSAEQAKEL 493 ++T A E E KEL Sbjct: 130 EET-EKAAEKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 132 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 233 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 260 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 436 K E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 437 KKTGPPAVEVTSAEQAKEL 493 ++T A E E KEL Sbjct: 130 EET-EKAAEKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 132 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 233 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 260 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK 436 K E + I++ +VD + + + YPT F NG + Y G R + + +++ Sbjct: 70 KAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVV 129 Query: 437 KKTGPPAVEVTSAEQAKEL 493 ++T A E E KEL Sbjct: 130 EET-EKAAEKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 132 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 233 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 32.3 bits (70), Expect = 0.37 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +3 Query: 147 KANFETVITTTEYILVEFYAPWCGHCKSLAP 239 K+ F+++ + + ++++F A WCG CK++ P Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEP 63 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.37 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAP 239 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 284 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 424 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = +2 Query: 296 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG---PPAVEV 466 +V+A + +++E+Y V P FF++G +D G + + + K G P ++ + Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSITPASLGL 116 Query: 467 TSAEQAKELIDANTLLYLVSFRTRAQP 547 + E + N S + RAQP Sbjct: 117 AAGPTILETVKKNA---KASGQDRAQP 140 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 31.5 bits (68), Expect = 0.64 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +3 Query: 93 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEY 245 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ + Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASF 388 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +3 Query: 126 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEY 245 EN++ LS+ E ++ E +V YAPWC C+++ Y Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASY 395 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 31.5 bits (68), Expect = 0.64 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 260 KLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 388 +L+E+ S + VD + D + S+ ++ PT F +NG I Sbjct: 69 ELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQI 111 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAKAQQ 260 ++ F A WCG CK +AP + + + Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSE 72 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 31.1 bits (67), Expect = 0.85 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = +2 Query: 263 LAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 439 LA++ + KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 52 LAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYA 248 I+++F A WC C+ +AP +A Sbjct: 30 IVIDFTATWCPPCRFIAPVFA 50 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 31.1 bits (67), Expect = 0.85 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 138 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAQQ 260 +L++ NF + I ++L+ PWCG +SL E + Q Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQ 69 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 159 ETVITTTEYILVEFYAPWCGHCK 227 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 335 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 448 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPEYAK 251 ++V+F++P CG CK+L P+ K Sbjct: 116 VVVDFFSPSCGGCKALHPKICK 137 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 153 NFETVITTTEYILVEFYAPWCGHCKSLAP 239 +F + + + ++V+F A WCG C+ + P Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEP 67 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = +2 Query: 263 LAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 421 +A++ + + K+D + D+A+ + V PT + G I+ G + D++ Sbjct: 72 MADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDEL 124 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPE 242 ++V+FYA WCG C +A E Sbjct: 97 LIVDFYATWCGPCILMAQE 115 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 269 EEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSP 385 E ES + KVD E + A VRG PTL FF + P Sbjct: 122 EYESNAIIVKVDTDDEYEFARDMQVRGLPTL-FFISPDP 159 >At1g04700.1 68414.m00467 protein kinase family protein low similarity to EDR1 [Arabidopsis thaliana] GI:11127925; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1042 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +1 Query: 616 KVIKELEAEDEDVVLFKNFEEKRVKYEDEEITEDLLNAWV 735 +V+ + ED D + F N E KR K + E+T+++ N+W+ Sbjct: 459 RVVATSKWEDSDDIYFNNPEGKRCK--ELELTKEVPNSWI 496 >At4g05490.1 68417.m00830 F-box family protein (FBL22) contains similarity to N7 protein GI:3273101 from [Medicago truncatula] Length = 307 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 496 RCQYFIVFGFFSDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDED 651 +C +FG Q R K F V+DD + I SD I++ + E+E+ Sbjct: 237 QCFNINLFGDLERQCLERIKDFRCPNDVLDDYNYVIFSDNGSIEDEKGEEEE 288 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +3 Query: 186 ILVEFYAPWCGHCKSLAPE 242 ++V+F++P CG CK+L P+ Sbjct: 120 VVVDFFSPGCGGCKALHPK 138 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 177 TEYILVEFYAPWCGHCKSLAP 239 T +++V F A WCG C+ + P Sbjct: 227 TPHVMVMFTARWCGPCRDMIP 247 >At1g26680.1 68414.m03250 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 920 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 282 GDSSSASFVVPWRIPVPEICSGRTMEHRIQLKCT 181 GDS V W+ PV +C ++ H+ L+C+ Sbjct: 340 GDSFKFKLVGTWKKPVLSLCPTQSNNHKTPLECS 373 >At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 917 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 607 SDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEE 705 SD ++ + E+ED VLF+ + + R+K D E Sbjct: 520 SDHGNVESIRLEEEDAVLFEPWLKSRLKSRDRE 552 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 299 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 421 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 498 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 397 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At2g27350.3 68415.m03293 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 506 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/107 (21%), Positives = 45/107 (42%), Gaps = 3/107 (2%) Frame = +2 Query: 167 NYNHGVHFS*ILCSMVRPLQIS-GTGIRQGTTKLAEEESPIKLAKVDATQEQDLAESYGV 343 +Y+HG H++ S+V P +++ G G+ + + A + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALLA 381 Query: 344 RG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 478 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 382 EGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g27350.2 68415.m03292 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 505 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/107 (21%), Positives = 45/107 (42%), Gaps = 3/107 (2%) Frame = +2 Query: 167 NYNHGVHFS*ILCSMVRPLQIS-GTGIRQGTTKLAEEESPIKLAKVDATQEQDLAESYGV 343 +Y+HG H++ S+V P +++ G G+ + + A + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALLA 381 Query: 344 RG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 478 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 382 EGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 >At2g27350.1 68415.m03291 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 505 Score = 27.9 bits (59), Expect = 7.9 Identities = 23/107 (21%), Positives = 45/107 (42%), Gaps = 3/107 (2%) Frame = +2 Query: 167 NYNHGVHFS*ILCSMVRPLQIS-GTGIRQGTTKLAEEESPIKLAKVDATQEQDLAESYGV 343 +Y+HG H++ S+V P +++ G G+ + + A + A QE + + Sbjct: 326 SYHHGNHYN----SLVDPHRLTVGAGLGFSSLSGRHVDKEQVKAAIKAQQEHQIDNALLA 381 Query: 344 RG--YPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAE 478 G Y L+ +A+ ++ W K + GP ++AE Sbjct: 382 EGRFYSDLELTEKEIERSVMEASRAEYLMEWSKPRIGPKESSTSNAE 428 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,469,492 Number of Sequences: 28952 Number of extensions: 304008 Number of successful extensions: 1089 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -