BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0052 (786 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 28 1.3 SPBC56F2.03 |||actin-like protein Arp10 |Schizosaccharomyces pom... 27 3.0 SPAC3G9.15c |fcf2||rRNA processing protein Fcf2 |Schizosaccharom... 27 4.0 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 27 4.0 SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom... 26 5.3 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 28.3 bits (60), Expect = 1.3 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = +1 Query: 541 SSTGKSLKTATSSTMLRSLNTSRRNS*VSKPIRFVASRVTPRTSSGS*PRTTGKTCLS 714 SST S +SS SLN++ + S I S TP TSS S T + S Sbjct: 214 SSTAASNSATSSSLASSSLNSTTSATATSSSISSTVSSSTPLTSSNSTTAATSASATS 271 >SPBC56F2.03 |||actin-like protein Arp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 27.1 bits (57), Expect = 3.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 87 SLPVWLWVCWPRKTHAIRTSTKDA 158 ++P+ LW+C P T + TST+DA Sbjct: 94 NVPITLWICAP-LTAILSTSTRDA 116 >SPAC3G9.15c |fcf2||rRNA processing protein Fcf2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 26.6 bits (56), Expect = 4.0 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +3 Query: 507 GTQKQLAERIFFIHREVTKNSDLLHDAEITQYIEEEFVSQQADTIRSLAGHTSDLKR 677 G Q + RI R+ T +LLHD+E Y +++++ Q + G L++ Sbjct: 166 GPQDFYSSRIPTRERKETIVDELLHDSERRSYFKKKYLELQKSKMSGRKGQYKKLQQ 222 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 591 ITQYIEEEFVSQQADTIRSLAGHTSDLKRFITENNG 698 I Q +++FV + + L + + KR +TENNG Sbjct: 327 IRQLEQQKFVEIASQRAKELDVYMEEFKRSLTENNG 362 >SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 641 Score = 26.2 bits (55), Expect = 5.3 Identities = 14/56 (25%), Positives = 21/56 (37%) Frame = +1 Query: 73 GVCSHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVLRPIQGQPRCSERTEG 240 G+ CL GC G G +L+ + R + A R + + E EG Sbjct: 292 GIYGAGCLITEGCRGEGGYLLNSKGERFMERYAPTAKDLASRDVVSRAMTVEIREG 347 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,897,406 Number of Sequences: 5004 Number of extensions: 54510 Number of successful extensions: 149 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -