BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0050 (718 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68159-10|CAD30432.1| 826|Caenorhabditis elegans Hypothetical p... 28 5.8 Z68159-9|CAA92282.2| 844|Caenorhabditis elegans Hypothetical pr... 28 5.8 AF339059-1|AAL50361.1| 826|Caenorhabditis elegans Rho guanine n... 28 5.8 AF326352-1|AAL50355.1| 844|Caenorhabditis elegans putative Rho ... 28 5.8 AB060647-1|BAB43906.1| 826|Caenorhabditis elegans putative GDP-... 28 5.8 >Z68159-10|CAD30432.1| 826|Caenorhabditis elegans Hypothetical protein C33D9.1b protein. Length = 826 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/32 (31%), Positives = 23/32 (71%) Frame = +3 Query: 501 SLRIWDSACRVASILIQRAPYLYLTSGFSDAY 596 S+R W + R+A+++ ++AP+L + S +++ Y Sbjct: 363 SIRDWHTTKRIANVVRKQAPFLKMYSEYTNNY 394 >Z68159-9|CAA92282.2| 844|Caenorhabditis elegans Hypothetical protein C33D9.1a protein. Length = 844 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/32 (31%), Positives = 23/32 (71%) Frame = +3 Query: 501 SLRIWDSACRVASILIQRAPYLYLTSGFSDAY 596 S+R W + R+A+++ ++AP+L + S +++ Y Sbjct: 363 SIRDWHTTKRIANVVRKQAPFLKMYSEYTNNY 394 >AF339059-1|AAL50361.1| 826|Caenorhabditis elegans Rho guanine nucleotide exchangefactor FGD-1 protein. Length = 826 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/32 (31%), Positives = 23/32 (71%) Frame = +3 Query: 501 SLRIWDSACRVASILIQRAPYLYLTSGFSDAY 596 S+R W + R+A+++ ++AP+L + S +++ Y Sbjct: 363 SIRDWHTTKRIANVVRKQAPFLKMYSEYTNNY 394 >AF326352-1|AAL50355.1| 844|Caenorhabditis elegans putative Rho guanine nucleotideexchange factor FGD-1 protein. Length = 844 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/32 (31%), Positives = 23/32 (71%) Frame = +3 Query: 501 SLRIWDSACRVASILIQRAPYLYLTSGFSDAY 596 S+R W + R+A+++ ++AP+L + S +++ Y Sbjct: 363 SIRDWHTTKRIANVVRKQAPFLKMYSEYTNNY 394 >AB060647-1|BAB43906.1| 826|Caenorhabditis elegans putative GDP-GTP exchange factor protein. Length = 826 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/32 (31%), Positives = 23/32 (71%) Frame = +3 Query: 501 SLRIWDSACRVASILIQRAPYLYLTSGFSDAY 596 S+R W + R+A+++ ++AP+L + S +++ Y Sbjct: 363 SIRDWHTTKRIANVVRKQAPFLKMYSEYTNNY 394 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,598,750 Number of Sequences: 27780 Number of extensions: 306475 Number of successful extensions: 600 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -